SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011869 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011869
Domain Number 1 Region: 165-297
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-41
Family C-type lectin domain 0.0000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011869   Gene: ENSCPOG00000013185   Transcript: ENSCPOT00000013312
Sequence length 299
Comment pep:known scaffold:cavPor3:scaffold_42:14940156:14943246:-1 gene:ENSCPOG00000013185 transcript:ENSCPOT00000013312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVRYSQWDSSPEEVPGGHWGRWEHLRRWVFSLALAILAVTVLWALILSVISSKASTER
GALLAHQDLLRTNASKQTAALGALKGEVGACQSCCETPAGQLDAQRGAGGSGGDGGEAQV
KLTQQKSALEELSLRVTQDLATAGRDRENIRNELFRALEAAKLQNGSCGQCPTSWLPFRG
SCYYFSEPRTTWQEAERNCVGNAAHLVIIGDLDEQGFLTRHTRGRGYWLGLRAVRSGGRV
QGYQWVDGVSISFSHWNVGEPNDSQSKEDCVMMLHSGLWNDAPCSSERDGWICEKRSSC
Download sequence
Identical sequences 10141.ENSCPOP00000011869 ENSCPOP00000011869 ENSCPOP00000011869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]