SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012415 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012415
Domain Number 1 Region: 612-819
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000249
Family Mannose 6-phosphate receptor domain 0.0076
Further Details:      
 
Domain Number 2 Region: 47-76,233-374
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000445
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 3 Region: 544-618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000115
Family Growth factor receptor domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012415   Gene: ENSCPOG00000013780   Transcript: ENSCPOT00000013920
Sequence length 972
Comment pep:known scaffold:cavPor3:scaffold_31:24894294:24953976:-1 gene:ENSCPOG00000013780 transcript:ENSCPOT00000013920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCGCLQSDYHFEYTECDSSGSRWRVAVPNAAVDCAGLPDPVRGKECTFSCGSGEYLEMRN
QVCSKCAEGSYSLGSGIKFDEWDELPAGFSNVATFMDTVLGPLDSRPDSCSNSSWTPRGN
YIESNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCRDMDSATDKWVKL
TDSGEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKAGT
FSSKPGAFSCQVCPRNTYSEKGATECMRCDEDSQFSEEGSSECTERPPCTTKDYFQIHTA
CDQEGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFHNNGSSSCHPCPPGT
YSDGTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQS
GAGGSDNDYLILNLHIPGFKPPTSLTGATGSELGRITFVFEMLCSADCVLYFMVDINRKS
TNVVESWGGTKEKQAYTHLIFKNATFTFTWAFQRTSQGQDNRRFIKDVVKIYSITASNAV
DGVASSCRTCALGSEQSGSSCVPCPPGHYIEKEANQCQECPPDTRLSTHQVYGKEACIPC
GPGSRSSQDHSVCYSDCFFYHEKENRSLHYDFSNLSSVGSLMNGPSFTSKGTKYFHFFNI
SLCGHEGKKMAFCTNNISDFTLKETVVGSDDYVNLVGAFVCQSTIIPSESKGFRAALSSQ
SIILADTFLGVTVESTLQNINIKEDMFPVSPSQVPDVHFFYKSSTTTPSCSDGRSTAVKM
RCNPVKAGVGVISVPSKCPAGTCDGCAFYFLWESAEACPLCTELDFHAIEGACKRGLQET
LYVWNEPKWCIKGISLPEKKLSACETIDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLE
YKYSKLVMTTNSKEGELPAADSCAIMEGEDNEEEIMYSNKQSLLGKLKSLATKEKQEHFE
SVQLKSSRSPNI
Download sequence
Identical sequences ENSCPOP00000012415 10141.ENSCPOP00000012415 ENSCPOP00000012415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]