SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012594 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012594
Domain Number 1 Region: 1306-1532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-40
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 336-448
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-29
Family Cadherin 0.00091
Further Details:      
 
Domain Number 3 Region: 660-767
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 769-874
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.00066
Further Details:      
 
Domain Number 5 Region: 1556-1753
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-27
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 6 Region: 230-334
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-27
Family Cadherin 0.00066
Further Details:      
 
Domain Number 7 Region: 441-563
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.00061
Further Details:      
 
Domain Number 8 Region: 126-228
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 875-976
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.0016
Further Details:      
 
Domain Number 10 Region: 563-664
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 978-1081
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000243
Family Cadherin 0.01
Further Details:      
 
Domain Number 12 Region: 1246-1285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 1757-1790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000321
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 1886-1926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000427
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1792-1838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000962
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012594
Domain Number - Region: 1936-1987
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00115
Family Hormone receptor domain 0.0076
Further Details:      
 
Domain Number - Region: 1226-1250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00313
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012594   Gene: ENSCPOG00000013977   Transcript: ENSCPOT00000014118
Sequence length 2903
Comment pep:known scaffold:cavPor3:scaffold_160:1748283:1843215:1 gene:ENSCPOG00000013977 transcript:ENSCPOT00000014118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPVRVLLANWGAPTAMSPHPRLGARQRRRLGPGIGGASRSPATQGAASSVHSALAPLAL
DPARRCPPPGGPVRLRLRCAVRRSPDSVPGELQLDPPSGTLPPILLRARSRVSRRARRGA
GGSTNPQFPLPSYQVSVPENQPAGTTVIELVAHDPDEGEAGRLSYQMEALFDERSNGYFL
IDGATGTVSTARELDRETKDTHVLKVSAVDHGSPRRSAATYLTVTVSDTNDHSPVFEQSE
YRERVRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGSGGVFEIDARSGVVRTRAVVDR
EEQAEYQLLVEANDQGRNPGPLSATATVHILVEDENDNYPQFSEKRYVVQVPEDLAVNTP
VLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLDVINPLDFEAIREYTLRIKAQ
DGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQATVLENVPLGHSVLHIQAVDADSGEN
ARLSYRLVDTGSAAVGVGSAGPEDPDSTPDFPFQIHNSSGWITVCAELDREAVEHYSFGV
EAVDHGSPPMSSSASVSITVLDVNDNDPVFTQPLYELRLNEDAAVGSSVLTLRARDRDAN
SVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASDGTRSHTVQVFI
NVTDANTHRPVFQSSHYTVSVSEDRPVGTPIATISATDEDTGENARITYVLEDPVPQFRI
DPDTGTIYTMTELDYEDQAAYTLAITARDNGIPQKSDTTSLEILILDANDNAPRFLRDFY
QGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLD
RENVAVYNLRALAVDRGIPAALSASVDIQVTVLDINDNPPVFERDELELFVEENSPVGSV
VAKIHANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALAELDFEVRRDYMLVVQAT
SAPLVSRATVRIHLLDQNDNPPELPDFQILFNNYVTNKSNSFPSGVIGRIPAHDPDLSDS
LNYTFLRGNELHLLLLDSATGELQLSRDLDNNRPLEALMEVSVSDGIHSVSALCTLRVTI
ITDDMLTNSITVRLENMSQEKFLSPLLSLFVEGVATVLSTTKDDVFVFNIQNDTDVSSNI
LNVTFSALLPGGVRGRFFPSEDLQEHIYLNRTLLTAISAQRVLPFDDNICLREPCENYMK
CVSVLRFDSSAPFISSASVLFRPIHPITGLRCRCPPGFTGDYCETEIDLCYSSPCSPNGR
CRSREGGYSCECLEDFTGEHCQVNARSGRCANGVCKNGGTCVNLLIGGFHCLCPPGQFER
PFCEVSTRSFPPESFVTFRGLRQRFHFTVSLQFATQEPNALLLYNGRFNEKHDFIALEVV
GEQVQLTFSAGETTTTVTPQVPGGVSDGRWHSVQVQYYNKPNIGRLGLPHGPSGEKVAVV
TVDDCDTAVAVHFGSYVGNYSCAAQGTQSGSKKSLDLTGPLLLGGVPNLPEDFPVRNRQF
VGCMRNLSIDGQSVDMAGFIANNGTRAGCAAQRNFCEAAVCQHGGTCVNRWSTYLCHCPL
HFGGKNCEQVMPHPQRFSGESLVSWSDLDITISVPWYLGLMFRTRKEDGVLLEATAGTLS
RLHLQILNSYVQFEVSHGPSDVASMQLSRSRVTDGEWHHLLIELRSAKEGKDIKYLVVMT
LDYGVDQNTVQIGNQLPGLKMRSVVIGGLSEDKVSVRRGFRGCMQGVRMGETSTNIATLS
MKDALKVRVKDGCDTEDPCASSPCPQHSRCRDTWDGYACDCDRGFFGRRCVDACQVNPCK
HLATCEHAPSSPRGYVCKCEAGHYGQYCENRIDLPCPKGWWGNPVCGPCHCAVSQGFDPD
CNKTNGQCQCKENYYKPPAQDACLPCDCFPHGAHNRACDMDTGQCACKPGVIGRQCNRCD
NPFAEVTSLGCEVIYNGCPRAFEAGIWWPQTKFGQPAAVPCPKGSVGNAIRHCSGEKGWL
PPDLFNCTSSSFMGLKVTNEKLGRNESRLDTDQALRLVKALRNATRLGGALFGSEVRTAY
QLLARVLQHESRQQGFDLAATRDADFHEDVVHTGSALLAPDTRAAWEQIQRGEAGVAQLL
RHFEAYFSNVAHNLRRTYLRPFVLVTANMILAVDVFDKFNFTGARVPRFEDIKDDFPREL
ESSVSFPADVFKPLEKKALHQGPLKVADGLRRAMPHMTRSSPGAQTEAPVGRHRRHPDGP
GQFAVALVIVYRTLGQLLPEHYDPDRRSLRLPSRPVINTPVVSTLVHSEGALRAGSLERP
VLLEFTLLETEERSKPVCVFWNHSLDIGGTGGGWSAKGCELVSRNRTHVTCQCSHVTSCA
VLMDVSRREHGEVLPLKIITYASIVLSLAALLVAFILLTLARTLRSNLHSIHRNLTAALF
ASQLVFVVGISQTENPFLCTVVAILLHHTYMGTFAWTLVEGLHVYRMLTEVRNIDAGPMR
FYYVVGWGIPAIVTGLAVGLDPQGYGNPDFCWLSLHDSLIWSLAGPIGAVILINTVIFVL
SVKVSCQRKHHYYERKGVRGSHRVAMGLETALVETGLWGTKRVNSDVLAFHYLFAAFSCV
QGLFVLLSHCVLNREVRKHLRALLAGKKLHLDDSATTRATLLTRSLNCNNTYSEGPDMLR
TALGESTASLDSTTRDEGVQKLSVSSGPARGDHREPPDPSYVPRDSKKPPGPDSDSDSEM
SLDEHSSSYASSHSSDSEDDVRDAEDKWDSARGPVHSTPKANALANHTPAGWPEESLAGS
DSEDPGPEPPLRVETKVSVELHRQEQANHCSSCPSDPAKPAAALGTQLPEQRKGILKNKV
TYPPPLPDQPLKCRLREKLADCEQSPASSRTSSLGSGDGIHAPDCVITIKTARREPGREH
LNGVAMNVCVGSAQAEGSDSEKP
Download sequence
Identical sequences ENSCPOP00000012594 ENSCPOP00000012594 10141.ENSCPOP00000012594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]