SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012858 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012858
Domain Number 1 Region: 86-234
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-38
Family C-type lectin domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012858   Gene: ENSCPOG00000014272   Transcript: ENSCPOT00000014414
Sequence length 237
Comment pep:novel scaffold:cavPor3:scaffold_28:807271:815179:-1 gene:ENSCPOG00000014272 transcript:ENSCPOT00000014414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEITYAEVRFKTESKSSGTTSLSPDASKKKITSHQSNIGFPKLLLITLLILFLLLVIL
FLVAFIIIFHKYSQLLQEKKIPIESSKTHQELECIKTNSTTKGKIWSCCPKNWKSFSVHC
YLFSNDFKTWNESAENCYRMEAHLVVINSKEEQDFIIQNLKIISAYVGLSDPEGQKQWQW
VDHSPYNETAAFWFRKQPKNSLGRCVILTLSFGEWGWNNISCHTKKRSVCEMMKIYL
Download sequence
Identical sequences H0VQM9
ENSCPOP00000012858 ENSCPOP00000012858 10141.ENSCPOP00000012858 XP_003470478.2.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]