SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012962 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012962
Domain Number 1 Region: 431-616
Classification Level Classification E-value
Superfamily vWA-like 4.01e-56
Family Integrin A (or I) domain 0.0002
Further Details:      
 
Domain Number 2 Region: 2296-2508
Classification Level Classification E-value
Superfamily vWA-like 6.08e-56
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1175-1379
Classification Level Classification E-value
Superfamily vWA-like 1.17e-55
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 4 Region: 127-316
Classification Level Classification E-value
Superfamily vWA-like 4.45e-53
Family Integrin A (or I) domain 0.0001
Further Details:      
 
Domain Number 5 Region: 2525-2728
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-30
Family Laminin G-like module 0.046
Further Details:      
 
Domain Number 6 Region: 633-802
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-24
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1941-2107
Classification Level Classification E-value
Superfamily Fibronectin type III 3.63e-23
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 1757-1926
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 9 Region: 1569-1728
Classification Level Classification E-value
Superfamily Fibronectin type III 4.37e-21
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 10 Region: 815-986
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-19
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 11 Region: 1386-1473
Classification Level Classification E-value
Superfamily Fibronectin type III 1.9e-19
Family Fibronectin type III 0.00039
Further Details:      
 
Domain Number 12 Region: 1002-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-19
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 13 Region: 2120-2205
Classification Level Classification E-value
Superfamily Fibronectin type III 1.08e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 14 Region: 1473-1564
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-17
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 15 Region: 333-421
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 16 Region: 27-109
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000361
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 17 Region: 2210-2295
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000277
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012962   Gene: ENSCPOG00000014388   Transcript: ENSCPOT00000014533
Sequence length 3089
Comment pep:known scaffold:cavPor3:scaffold_4:48149542:48249313:-1 gene:ENSCPOG00000014388 transcript:ENSCPOT00000014533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRLPAALAALGAALLLLAAVEAEVDPPSDLNFKIIDENTVHMSWEKPVDPIVGYRITV
DPTTDGPTKEVTLAASVTETLLTDLIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPSK
PGEKKPGKTELQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRV
GVVQYSSDTRTEFNLNQYYQRDELLAVPYKGGNTMTGDAIDYLVKNTFTESAGARVGFPK
VAIIITDGKSQDEVEIPARELRDIGVEVFSLEGIKAADAKELKQIASTPSLSHVFNVANF
DGIVDIQNEIISQVCTGVDEQLGELVSGEEVVVEPPSNLVAAEVSSKYVKLRWDPSPSPV
TGYKVLLIPMAAGGRQLALSVGPQTTMLNVRDLTADMEYQISVSAMKGLTSSEPISITEK
TQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLAKSFEISPNRVQISL
VQYSRDPHTEFTLKEFTKVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPNKGSRSNV
PKVMILITDGKSSDAFREPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVED
FDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKNLSFSEVTSDSFKVNWDPAGENVLS
YHITYKEATEDDSVTVVEPASSTSVVLSNLKPETLYMVNMTAEYEDGFSVPTAGEETTQE
VKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRILYRPVTGGESKEVTTPANQRRRTLEN
LTPDTKYEVSIIPEYFSGPGSPLTGNAATENEVRGNPRDLRVSDPTTSTLKLSWSGAPGK
VKQYLVTYTPVAGGDTQEVTVRGDKTNTVLRRLSEGTKYTLSVTALYASGAGEALFGEGA
TLEERGSPQNLVTKDITDTTIGAYWTSAPGMVRGYRVSWKSLYDDIDTGEKNLPGDTVHT
VIENLQPETKYKISIFATYGSGEGEPLTGDATTELSKDSKTLKVDEETENTMRVTWRPAP
GKVVNYRIVYRPQGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPVLSSGMECLTRAEADI
VLLVDGSWSIGRTNFRTVRSFISRIVEVFEIGPKRVQIGLAQYSGDPRTEWQLNAHRDKK
SLLQAVANLPYKGGNTLTGLALNFIRQQNFKTQAGLRTRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAVEGIKNADEDELKMIATDPDDIHAYNVADFESLSSIVDDLTTNLCNSV
KGPGDLEAPSNLVISERTHRSFRVSWTPPSDSVDRYKVEYYPVTGGKRQEFYVSRLETST
VLKELKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDVGPTTMRVQWQPVGG
ATGYTLSHQPTDTTKPAKPKEMRVGPTVNDVQLTDLLPNTEYEVTVQAVLHDLTSEPATA
REVTLPLPRPRNVRLRDVTHSTMTVLWEPVLGKVRKYVVRYKTPEEDVKEVEVDRSRAST
TLRDLHSQTLYTVSVSAVYDEGESPPVTAEDTTRSVPAPTNLRLTEVTPESFRGTWDHGA
SDVALYRVTVAPMGSSEKKEVMLNGDENTLVFENLNPNTLYEVSVTAIYPDESESEDLVG
SERTLRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRIIYQPSTGEGNEQ
TITVGGRQNSVVVQKLKPDTPYTFTVSSLYPDGEGGRMTGRGKTKPLTTVRNLRVYDPST
STLSVRWDHAEGNPRKYKLFYAPVASGAEELVPIPGNTNYAILRNLQPDTLYTITVVPVY
PEGDGGRTSDTGRTLVRGLARNIEVYNPTPNSLDVRWDPAPGPVQQYRIVYSPADGTKPS
ESIVVPGNIRKVQLERLIPDTVYSVNIVAIYSDGEGMPSPSQGRTLPRSGPRNIRVFDET
TNTLSVTWDHADGPVQQYRIIYSTTVGDPIDEYTTVPGRRNNIILQSLQPDTPYKITVIA
VYEDGDGGHLTGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNE
PMEAFVGEVTSYTLHNLNPSTTYDVNVYAQYDSGFSVPLTDQGTTLYLNVTDLKTYQVGW
DTFCVKWSPHRAATSYRLKLSPADESGTRGQEITVRGSETSHCFTDLSPEAEYSATVFVQ
TPNLEGPGVLVKEHTTVKPTEAPTTPPTPSPPPTIPPAREAVCKGAKADIVFLTDASWSI
GDDNFNKVVKFIFNTVGAFDEVSPAGKMVSFVQYSDEVKSEFKLNTYNDKALALGALQNI
RYRGGNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAAFVIQQSGFS
VFVVGVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLD
GYTSPGFKMLEAYNLTEKSFASVQGVSLESGSFPSYSAFRLQKNAFLHQPTVDVHPNGLP
PSYTIILLFRLLPETPNDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDTRGEVQTVT
FDTDEVKALFYGSFPKVHIVVTSKSVKIYIDCYEIVEKDIKEAGNITTDGYEILGKLLKG
ERKSATFQIQSFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGP
AGGPGAKGPRGERGLNGAIGPPGPRGDTPNGLSIPGEQGRQGMKGDAGEPGLPGRTGTPG
LPGPPGPIGPPGDRGFTGKDGAMGPRGPPGPPGTPGSPGVAGPSGKPGKPGDHGRPGPSG
LKGEKGDRGDIASQNMMRAVARQVCEQLIHGQMNRFNQMLNQIPNDYHSNRNQPGPPGPP
GPPGSVGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGTGSPGPRGLPGPPGPQG
ESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQGYPEPFVPEG
YLPERQPFVPPVEPERTADYEEDYGADEP
Download sequence
Identical sequences ENSCPOP00000012962 10141.ENSCPOP00000012962 ENSCPOP00000012962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]