SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013005 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013005
Domain Number 1 Region: 41-176
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-38
Family C-type lectin domain 0.000000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013005   Gene: ENSCPOG00000014439   Transcript: ENSCPOT00000014584
Sequence length 178
Comment pep:known scaffold:cavPor3:scaffold_37:10581356:10583825:1 gene:ENSCPOG00000014439 transcript:ENSCPOT00000014584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDTMLPSTALRGMSWALLSCMMLLSQVQAEDSQDKIASPRISCPKGSKAYGSYCYAFFKT
PKSWVDADLACQKRPSGHLTSVLSGAEGSFVSSLIQSTVTSYQYVWIGLHDPTLGQEPNG
GGWEWSSTDVLDYFNWDRNPSTASDRGFCGSVSRISGFLKWRDYKCDVQLPYVCKFKN
Download sequence
Identical sequences 10141.ENSCPOP00000013005 ENSCPOP00000013005 ENSCPOP00000013005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]