SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013204 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013204
Domain Number 1 Region: 421-652
Classification Level Classification E-value
Superfamily GFP-like 3.87e-91
Family Domain G2 of nidogen-1 0.00000000191
Further Details:      
 
Domain Number 2 Region: 935-1190
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-47
Family YWTD domain 0.000000000636
Further Details:      
 
Domain Number 3 Region: 803-911
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.24e-24
Family Thyroglobulin type-1 domain 0.00053
Further Details:      
 
Domain Number 4 Region: 375-418,663-750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000895
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 754-833,869-882,1192-1236
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000144
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013204   Gene: ENSCPOG00000014654   Transcript: ENSCPOT00000014799
Sequence length 1238
Comment pep:known scaffold:cavPor3:scaffold_16:4952644:5036417:-1 gene:ENSCPOG00000014654 transcript:ENSCPOT00000014799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVASGRSGAAWTRALLLQLLLAGPGGCLSRQDLFPFGPSQGDLELEDGDDIVSPALELS
EALRFYDRSDIDSVYVTTNGIIAMSEPPAKESHPGLFPPTFSAVAPFLADLDTTDGLGKV
YYREDLSPSITQLAAEYVQRGFPEVSFQPSSVVVVTWESVAPYQGSSRNAAQEGQRNTFQ
AVLASSNASTYAIFLYPKDGLQFYKTFYKKEESQVPAMVAFSQGLVGFFWKSDGVYNIFA
NDSKSIENLTRSSNCGLEGAWVFEIGSPATAKGVVQAEVSLQPDNGAKFAGEVEDYDHMT
THLGLEDAATPSLPFKISKRGDIDTYDVPRALSPRHETTEGSRSFQLPVEKFPQQQPQVI
DVDEVEETGVVFSYTTDSQQTCASNRHQCSVHAECRDYRTGFCCSCVAGYTGNGRQCVAE
GSPQRVNGKVKGRIFVGSSHTPVVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLPLA
PIGGIIGWMFAVEQNGFKNGFSITGGEFTRQAEVTFVGHPGKLVIRQQFSGIDEHGHLTI
DTELEGRVPQIPAGSSVTIEPYTELYHYSGSVIMSSSTREYTVTEPEPAGAAPSHTYVYQ
WRQTITFEECVHDTARQALPSTQQLSVDSVFVLYNQEERILRYALSNSIGPVREGSPDAL
QNPCYIGTHGCDTNAACRPGQGTTFTCECSIGFRGDGRTCYDIDECSEQPSVCGSQAICN
NLPGTFRCECSEGYRFSDQGKCVAIVEQRPIDYCATGLHDCDIPQRATCIYTGGSSYTCS
CLPGFSGDGRACQDVDECQLSRCHPDAFCYNTPGSFMCQCKPGYQGDGFQCVPGEVEKTR
CQQEREHILGAVGAADTQRPRPPGLFVPECDEHGHYAPTQCHGSTGYCWCVDRDGRELEG
TRTRAGLQPPCLSTVPPVIDQRPALPTSVIPLPPGTHLLFAQTGKIERLPLEGNTMKKEE
AKAFLHVPEKIIIGLAYDCVDKMVYWTDITEPCIGRASLHGGEPAILVQQGLGSPEGIAI
DHLGRNMFWTDSHLDRIEVAKLDGTQRRVLFDTDLVNPRSIVTDPVRGNLYWTDWNRDNP
KIETSYMDGTNRRILAQDELVLPNGLTFDPFSSQLCWVDAGTHRAECLNPSQPSRRKVLP
GLEYPFAVTSFGKNLYYTDWKGNSVVAIDLTISSVTDTFHPHKQSRPYGITTTLAQCPQG
HNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCVEQ
Download sequence
Identical sequences ENSCPOP00000013204 ENSCPOP00000013204 10141.ENSCPOP00000013204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]