SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013252 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013252
Domain Number 1 Region: 622-921
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-80
Family Protein kinases, catalytic subunit 0.0000000412
Further Details:      
 
Domain Number 2 Region: 29-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-55
Family Ephrin receptor ligand binding domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 334-539
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-24
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 911-978
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.85e-20
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Domain Number 5 Region: 260-336,372-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000733
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013252   Gene: ENSCPOG00000014707   Transcript: ENSCPOT00000014852
Sequence length 979
Comment pep:known scaffold:cavPor3:scaffold_10:5125579:5139028:1 gene:ENSCPOG00000014707 transcript:ENSCPOT00000014852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRWARALGLLPLLLLCAPLRPGARAEEVTLVDTSKAQGELGWLLDPPEDGWSEVQQML
NETPLYMYQDCPLQENGDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGARPPGC
KETFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDKASGSVKLNVERCSLGHLTR
RGLYLAFHNPGACVALVSVRVFYQRCPETVHGLAQFPDTLPGPGSLVEVAGICLPHAQVG
AGPSAVPRMHCSPDGEWLVPVGQCFCEPGYEEGSGGVGCTACPRGSYRTDLSTSRCLKCP
HHSSADAEGATVCTCESGHYRAPGEGHQEACTRPPSAPGNLSFSVSGTQLSLRWEPPTDM
GGRQDVQYSVECLQCRGTAQDGGPCQPCGTGVHLSPGARELTTPSVKVEGLEPNANYTFN
IKSQNGVSRLSSSSPASASLRINMGQAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGGN
LSYELHVLHQDEEWYQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSPP
PASRSLTGGEIVAIIFGLLLGVALLVGIYICRSRRGQRQRQQRQRDRVTDVDREDKLWLK
PYVDLQAYEDPAQGALDFTQELDPDWLIVDTVIGEGEFGEVYRGILSLPRQDCKTVAIKT
LKDTSPDGQWWNFLREATIMGQFNHPHILHLEGVITKRKPIMIITEFMENGALDAFLKDR
EDQLAPAQLVAMLHGIASGMNYLSDHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDF
GGTYETQGGKIPIRWTAPEAIAQRTFTTASDVWSFGIVMWEVLSFGDKPYGDMSNQEVMK
SIEDGYRLPPPVDCPAPLYDLMKDCWAYERTRRPTFAQLQGQLEKLLADPYSLRTIANFD
PRVTLRLPSLSGSDGIPYRSVSEWLESIRMKRYILHFRSAGLDTMECVLELTAEDLTQMG
ITLPGHQKRILCSIQGFKD
Download sequence
Identical sequences A0A286XGT0
XP_003475292.1.53824 10141.ENSCPOP00000013252 ENSCPOP00000013252 ENSCPOP00000013252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]