SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013382 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013382
Domain Number 1 Region: 703-976
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.4e-68
Family Protein kinases, catalytic subunit 0.0000000203
Further Details:      
 
Domain Number 2 Region: 322-514
Classification Level Classification E-value
Superfamily L domain-like 6.81e-49
Family L domain 0.000000118
Further Details:      
 
Domain Number 3 Region: 28-204
Classification Level Classification E-value
Superfamily L domain-like 6.24e-46
Family L domain 0.00000021
Further Details:      
 
Domain Number 4 Region: 499-629
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.01e-21
Family Growth factor receptor domain 0.0000000616
Further Details:      
 
Domain Number 5 Region: 179-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.29e-20
Family Growth factor receptor domain 0.0000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013382   Gene: ENSCPOG00000014852   Transcript: ENSCPOT00000014997
Sequence length 1328
Comment pep:known scaffold:cavPor3:scaffold_9:42096340:42113867:-1 gene:ENSCPOG00000014852 transcript:ENSCPOT00000014997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASGALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRHPDAEIVVQDNG
RSCPPCHEACKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPDPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPLCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVNKNGINMCEPCGGLCPKACEGTGAGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGLRSLKEISAGRIYISANRQLCYHHSLNWTRLLRGPAED
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGQGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAYEAECFSCHPECQPMEGMATCNGSGSDACVQCAHFRDGPHCVSSCPHGVLGAKGPI
FKYPDVRNECRPCHENCTQGCKGPQLQDCLGQPLVLISKTHLALTVTVGLTVILLVLGIT
FLYWRGRRIQNKRAMRRYLERGESLEPLDPSEKANKVYARIFKETELRKLKVLGSGVFGT
VHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSS
LQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHSMVHRNLAARNVLL
KSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVW
ELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELA
NEFTRMARDPPRYLVIRRDSGSGIPPGAEPSTLTNKELEEVELEPELDLDSDLEAEEDSL
ATTLGSALSLSAGTLTRPRGSQSLLSPSSGYMPMNQSNLGEAPQESAVCGDSERCPRPVS
LHPVPRARLASESSEDHVTGCDTELQEKVSMCRSRSRSPRPRGDSAYHSQRHSLLTPVTP
LSPPGLEEEDVNGYVMPDTHLKGTSSSQEGTLSSVGLSSVLGKYEYMNRRRRHSLPRPPR
PGSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIIPTAGTTPDEDYEYMNRQRGSGTGG
DYAAMGACPAAEQGYEEMRAFQGPGHNAPHVRYARLKTLRSLEATDSAFDNPDYWHSRLF
PKANAQRT
Download sequence
Identical sequences 10141.ENSCPOP00000013382 ENSCPOP00000013382 ENSCPOP00000013382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]