SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013384 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013384
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily C-type lectin-like 1.62e-100
Family Sulfatase-modifying factor-like 0.000000000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013384   Gene: ENSCPOG00000014854   Transcript: ENSCPOT00000014999
Sequence length 283
Comment pep:novel scaffold:cavPor3:scaffold_16:31702237:31773417:-1 gene:ENSCPOG00000014854 transcript:ENSCPOT00000014999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLIPAGAFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNAEFEKFNSTGYLTEAEK
FGDSFVFEGMLSEKVKTDIQQAVAAAPWWLPVKGANWRHPEGPDSTIQHRPDHPVLHVSW
NDAVAYCTWAGKRLPTEAEWEYSCRGGLQNRLFPWGNKLKPKGQHYANLWQGEFPVTNTG
EDGFQGTAPVDAFPPNGYGLHNIVGNVWEWTSDWWTIYHSVDETLNPKGPPSGKDRVKKG
GSYMCHKSYCYRYRCAARSQNTPDSSASNLGFRCAANRLPTTD
Download sequence
Identical sequences ENSCPOP00000013384 ENSCPOP00000013384 10141.ENSCPOP00000013384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]