SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013453 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013453
Domain Number 1 Region: 284-448,509-615
Classification Level Classification E-value
Superfamily Kelch motif 7.32e-35
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 83-205
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 3 Region: 706-821
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000007
Family C-type lectin domain 0.0065
Further Details:      
 
Domain Number 4 Region: 991-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000013453
Domain Number - Region: 919-947
Classification Level Classification E-value
Superfamily Plexin repeat 0.000628
Family Plexin repeat 0.0035
Further Details:      
 
Domain Number - Region: 53-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013453   Gene: ENSCPOG00000014929   Transcript: ENSCPOT00000015075
Sequence length 1097
Comment pep:novel scaffold:cavPor3:scaffold_11:460301:732539:-1 gene:ENSCPOG00000014929 transcript:ENSCPOT00000015075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGGQGPALAPPQPDASGLWRARPSSWLLDRSSWLLSYGFLYLALYAQVSQSKPCEKTG
SCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYP
NAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEVRGNETVPEVVTTSGYA
LLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSVSSQVYCECDKYWKGEACDIP
YCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGRAS
HKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTVSRGPLQRYGHSLALYQQEN
IFMYGGRIETNHGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMELDSKDV
VMIIIFGYSAIYGYTSSIQEYHIYSNCWYLFPWVRWGSQQGFWNHHTKCIYDLVTRQFQV
HSNFSALIRNNLDIIDNIIKYEYNTTTRTILKESGFARYLHSAVLINGAMLIFGGNTHND
TSLSNGAKCFSADFLAYDIVACNEWKTLPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSV
LLNDILVYKPANCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNILRAKCPPKTAI
SDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVRNYTKCHVRNEQICNKLTSC
KSCSLNLNCQWDQRQQECQALPAHLCGEGWNHIGDACLRINSSRESYDNAKLYCYNLSGN
LASLTTSKEVEFVLDEIQKYTQQKVSPRGGLRKINISYWGWDFPSCLESINVNNVLRRVS
LAINYISTLSSLVNSIIQSVILWFHYHHRFQENISNLTVYELSILFLFEEIGGTRISYIL
SFSYSAFKEFITKNLNPAQNCSGLRTCGQCLEHPGCGWCNDPSNTGRGHCIEGSSRGPMK
LSGIHSEMTLDTNLCPKEKNYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDC
MPGYYGDPTNGGQCTACTCSGHANICHLHTGKCFCTTKGIKGDQCQLCDSENRYVGNPLR
GTCYCKYFSLMSYNFSY
Download sequence
Identical sequences 10141.ENSCPOP00000013453 ENSCPOP00000013453 ENSCPOP00000013453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]