SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013620 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013620
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013620   Gene: ENSCPOG00000015111   Transcript: ENSCPOT00000015258
Sequence length 593
Comment pep:known scaffold:cavPor3:scaffold_4:33749021:33758533:1 gene:ENSCPOG00000015111 transcript:ENSCPOT00000015258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCSDCHSNATCLEDGVITTCTCQDGFSGDGILCTDVDECAIPGASNCSANSSCVNTLGSY
TCACADGFLLRPGLGCIDVDECAEPGLNHCHALATCVNVDGNYSCVCPQGYVGSGLQCEC
TPGSCGLGLECLPEGQGGALVCVDPCHAYQTLDEYWRSAEYGAGFSCDLELRGWYRFVGQ
SGVRMANTCVPTQRCNTAAPLWLNGTHPSNNEGIVSRKACAHWSGHCCRWETQVHVKACP
GGYYVYNLTAPPECHLAYCTDPTSVEGTCEECSVDEDCISDNGRWHCRCKEDTNVTDVSL
LERRLECGVNDMKLSLSKCHLQNLGFKKVFMYLHDSRCSGFMERGERDWMSVVTPARHGP
CGTVLTTNETHATYSNTLYLANEIIIRDFNIKFNFECSYPLDMKVSLQTSLRPIVSSLNI
SVGGTGMFTVRMALFQSPAYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFVLLMTNCYA
TPSSNASDPMKYFIIQDRCPRSSDSTIQVMENGESTVGRFSVQMFRFAGNYDLVYLHCEV
YLCDRVNENCKPTCSGTRVRSGGSIDQSRVLNLGPITREGVQAAVSKATSSSL
Download sequence
Identical sequences ENSCPOP00000013620 10141.ENSCPOP00000013620 ENSCPOP00000013620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]