SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013736 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013736
Domain Number 1 Region: 479-657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-45
Family SPRY domain 0.0026
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.87e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 376-484
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000169
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000207
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000013736
Domain Number - Region: 105-161
Classification Level Classification E-value
Superfamily RING/U-box 0.00212
Family ZZ domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013736   Gene: ENSCPOG00000015240   Transcript: ENSCPOT00000015387
Sequence length 686
Comment pep:known scaffold:cavPor3:scaffold_46:13374862:13449121:-1 gene:ENSCPOG00000015240 transcript:ENSCPOT00000015387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSNCSSGETIEPLTAFQCPTCR
YVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSENRRERIYRPSSAMSSERIACQ
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHEN
EKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVA
NCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAESRVAMATASSQVLIPDINFNDAF
ENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYT
IFTGQANFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRL
KTNSQPFKLDPKMTHRKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSG
CHYWEVVMGSSTWYAIGIAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPP
QLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDF
IDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences 10141.ENSCPOP00000013736 ENSCPOP00000013736 ENSCPOP00000013736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]