SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013762 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013762
Domain Number 1 Region: 178-279
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-21
Family I set domains 0.0083
Further Details:      
 
Domain Number 2 Region: 58-145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000455
Family Growth factor receptor domain 0.0026
Further Details:      
 
Domain Number 3 Region: 130-175
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000486
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013762   Gene: ENSCPOG00000015270   Transcript: ENSCPOT00000015419
Sequence length 310
Comment pep:known scaffold:cavPor3:scaffold_11:13336705:13338878:-1 gene:ENSCPOG00000015270 transcript:ENSCPOT00000015419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQVHAGLPAIRATAASTRPLMLLLLGLWTLAPARAKPPPAPDPLRRGWQRLLAEGEACA
PCRPGECATPRGCLAGRVRDACGCCWECANLEGQLCDLDPSAHFYGRCGEQLECRLDVGD
ALSRGEVPEPRCACRTQRPLCGSDGRTYAQICRLREAARAQPDVNLTVAHPGPCESEPQI
LSQPHDVWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEV
TSWLQIQAVRPSDEGTYRCLARNALGQVEAPATLTVLTPEQLNSTGMPQQQSLSLAPEEE
AGNEESEDYY
Download sequence
Identical sequences H0VSY9
10141.ENSCPOP00000013762 XP_003475076.2.53824 ENSCPOP00000013762 ENSCPOP00000013762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]