SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013776 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013776
Domain Number 1 Region: 808-916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-22
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 276-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 624-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000118
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 5 Region: 240-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 201-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000686
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013776   Gene: ENSCPOG00000015286   Transcript: ENSCPOT00000015435
Sequence length 993
Comment pep:known scaffold:cavPor3:scaffold_15:36913738:36944611:-1 gene:ENSCPOG00000015286 transcript:ENSCPOT00000015435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAGRVPGLCLVVLLVHARAAQHGKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHVKFVLHTDGKTCIETC
AVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFE
CSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLYGVTHCGDVDE
CSINRGGCRFGCVNTPGSYQCTCPAGQGRLHWNGKDCTEPVKCQGSPGASKAMLSCNRSG
KKDTCALTCPSRARFLPESENGFTVSCGTPSPKAAAARAGHPGNSTSSSHCHEAAVLLVK
QRASFKVKDAKCRLHLRNKGKLEEAGRTPGSGSAPCSDCQVTFIHLKCDSSRKGKGRRAR
TPPGKEVTRLSLELEAEVRAEETTASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRL
AGLDYELAHKPGLGAGERAELVEVCRPGQHRAGAKCVSCPQGTYYHGQTEQCVPCPAGTF
QEREGQLSCDLCPGSDAHGPLGATNITTCAGQCPPGQHSADGFRPCQPCPRGTYQPEAGR
TLCFPCGGGLTTKHEGALSFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCT
RCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKR
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKT
SEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQ
NYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences ENSCPOP00000013776 XP_003473950.1.53824 ENSCPOP00000013776 10141.ENSCPOP00000013776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]