SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014075 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014075
Domain Number 1 Region: 163-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000952
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 108-255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000104
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014075   Gene: ENSCPOG00000015607   Transcript: ENSCPOT00000015760
Sequence length 529
Comment pep:known scaffold:cavPor3:scaffold_15:21858897:21883281:1 gene:ENSCPOG00000015607 transcript:ENSCPOT00000015760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSPALDPCSAYISLNEPWRNTDHQFDESQGTPLCDNHMDGEWYRFTGMAGDAMPTFCVP
ENHCGTHAPIWLNGSQPLESDGIVQRQACTSFKGNCCLWDTTVEVKACPGGYYVYRLSKP
SVCFHVYCGHFYDICDEDCHGSCLGTSQCTCSPGTVLGPDGQTCFDENECEQDNGGCSEI
CVNLKHSYRCECGVGRVLRSDGKTCEDIKGCHNNNGGCSHSCLGSEKGYQCECPRGLVLA
DDNHTCQVPVVCKSNAIEVNVPRELVGGLELFLTNTSCRGVSNGTHVNIFFSLKTCGTVV
NVVNDKIVASNLVTGLPKQTPGSSGDIIVRTSELLIPVTCEFPRLYTISEGYVPNLRSSP
LEILGRSHGVFPFTLEIFKDHEFEEPYREALPSLKLRDSLFFGIEPLVHVSGLESLVESC
FATPTSKVDEILKYYLIRDGCVSDDSVKQYSSRDHLAKHFQVPVFKFVGKDHKEVFLHCR
VLVCGMLDTRSRCAQGCHQRVRRAAGEGENTAGLQSQILTGGPISIDWE
Download sequence
Identical sequences ENSCPOP00000014075 ENSCPOP00000014075 10141.ENSCPOP00000014075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]