SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014166 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014166
Domain Number 1 Region: 651-762,791-855
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000817
Family Mannose 6-phosphate receptor domain 0.0094
Further Details:      
 
Domain Number 2 Region: 270-340,377-398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000186
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 3 Region: 581-658
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000251
Family Growth factor receptor domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014166
Domain Number - Region: 68-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0293
Family Growth factor receptor domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014166   Gene: ENSCPOG00000015712   Transcript: ENSCPOT00000015867
Sequence length 1011
Comment pep:known scaffold:cavPor3:scaffold_2:33289140:33365468:1 gene:ENSCPOG00000015712 transcript:ENSCPOT00000015867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGRSHHPSARGGGRSENRKSQLLHLLFWAGTAFQVTWGTGSEELHACKESEYHYEYTACD
STGSRWRVAVPHTPGLCTSLPDPVKGTECSFSCNAGEFLDMKDQSCKPCSEGRYSLGTGI
RFDEWDELPHGFASLSANMEIEDSTTESAENCTLSKWVPRGDYIASNTDECTATLMYAVS
LKQSGTVNFEYYYPDPNIIFEFFVQNDQCQPNVDDTRWMKTTEKGWEFHSVELNRGNNVL
YWRTTAFTVWSKVSNPVLVRNIGITGVAYTSECFPCKPGTYAAKQGSTFCKLCPANTYSN
KGEASCHPCDSDKYSEKGSSSCKMRPACTDKDYFYTHTACDANGETQLMYKWAQPKICDE
DAEGAVKLPESGVKTRCPPCNPGFFKTSNSTCEPCPYGTYSNGSDCTHCPAGTEPVLGYE
YKWWNTLPANMETTVLSGINFEYKGLTGWEVAGDHIYTAIGASDNDFMILTLVVPGFRPP
QSVTADTENKEVARITFIFKTICSMNCELYFMVGMNSRTNTPVETWKGSKVKQSYTYIIE
ENATMSFTWAFQRTTLHDTGRKYTNDVAKIYSINITNVMDGVASYCRPCAMEASDVGSSC
TSCPTGYYIDRNSGTCHPCPPNTILKAHQPYGAQACMACGPGTKSNKIHSLCYNDCRFSR
HASSRTYDYNFSALANTVSLSGGPSFTSKGLKYLHHFNLSLCGNEGKKMAVCTDNVTDLR
IPEGESGFSKSITAYVCQSVIIPSEVTGYKAGVSSQPVSLADRLVGVSTDVTVDGITSPA
ALFHPETLGIPDVIFFFRSNDVTQSCSSGRSTTIRLRCNPLKIAPGSLSLPSMCSDGTCD
GCNFHFLWESVAACPLCSAADYHTFVSSCVAGIQKTTYVWREPKICSGGISLPEQRVTIC
KTIDFWLKVGISGGTCSAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAVDSCA
IMEGEDVEDDLIFTSKKTLFGKIKSFTSKRTPDGFDSVPLKTSSGGPDMDL
Download sequence
Identical sequences 10141.ENSCPOP00000014166 ENSCPOP00000014166 ENSCPOP00000014166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]