SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014233 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014233
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000198
Family Galectin (animal S-lectin) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014233   Gene: ENSCPOG00000019487   Transcript: ENSCPOT00000022185
Sequence length 122
Comment pep:novel scaffold:cavPor3:scaffold_32:24785418:24787240:1 gene:ENSCPOG00000019487 transcript:ENSCPOT00000022185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSQVITLLGTVLSTAKGLYTNLFCKDDITFHSDPCFHENAGPQRGRNRDTDGTGPHCCPC
WGETVQGRGRRWGGDITCEAHCYKVTVDGHHLLAYAHVLKEFQDINYLEVVSDSCRTSNL
QW
Download sequence
Identical sequences ENSCPOP00000014233 ENSCPOP00000014233 10141.ENSCPOP00000014233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]