SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014368 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014368
Domain Number 1 Region: 117-256
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-24
Family C-type lectin domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014368   Gene: ENSCPOG00000026823   Transcript: ENSCPOT00000027328
Sequence length 257
Comment pep:novel scaffold:cavPor3:scaffold_28:4105243:4110138:1 gene:ENSCPOG00000026823 transcript:ENSCPOT00000027328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKNRPNEGIVQEQEITYTDVKISKNQQKQRVFKREQNPVLSSEQEVNYVEMKFHRTSHN
RAQLGGQKRKGTVNWTRAPSTAWKRIAGILAFVCIVLITVIGTLLSNLFSSREDQSRNFT
LFPTLSSKSNGCSSGLCSHNWIGYGNSYYHFSSEAKTWEESQSTCAKLNSHLLKVDSEED
LLNFLMIEMTGWIAFNINENNGSWVGKNVFQLNDNLQTGFLYNSGEGKNQSCAYVNGKSL
YTEDCSSRKLFICEFNI
Download sequence
Identical sequences 10141.ENSCPOP00000014368 ENSCPOP00000014368 ENSCPOP00000014368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]