SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014515 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014515
Domain Number 1 Region: 5-436
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.52e-105
Family L-arabinose binding protein-like 0.00095
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014515
Domain Number - Region: 445-504,567-584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014515   Gene: ENSCPOG00000020635   Transcript: ENSCPOT00000026635
Sequence length 784
Comment pep:known scaffold:cavPor3:scaffold_162:1965553:1978200:-1 gene:ENSCPOG00000020635 transcript:ENSCPOT00000026635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLMPNNYQSYLAFTFAIEEINRNPQLLPNISLGYEFHNFLYSHWKILENSFILLTGQYKI
PNYTCRRESKCAAVLMEMSWGTSAEIGPLLELYRFPQVTFGDYDPTLTDRGQYHSLHQVA
PKDTYLALGIVTLMFHFHWTWVGLIITADHKGLQFLSDVRAEIDRHGICVAFVKMVSTVT
VSYLSVIQKHDIFTADTSSVNVVVIYYDNDNRNDLHYNIVQSSVTWKVWVTNSQWHADLS
GRNFVLDTFHGVLVFSHHHEEISGFKNFVKEATPFKYPEDSYLFMYWYKNFHCSFSEPDC
ALENCTINASVAWLPPNSFDTAMSDGSYNIYNGVYAVAHALHAMLFEDVQRPPVKNRNVM
MFPHWELHPFLKNIQFSNPSGEQVILNDRRKLDSEYDILNFWNFPEGLRLKVKVGTFSPL
APNGQKMTLSENMIEWTTGITETPRSVCSESCIPGFRKSSQEGKAPCCFDCTPCAGNEIT
NDTDMEQCIKCPEHHYANAQQNHCLQKSVTFLAYEDPVGKALAGTALILTVLTAAVLGIF
VKHQDTPIVKANNQALSYTLLISLIFCFLCSLLFIGHPNTATCILQQTTFGVVFTVAVST
VLAKTITVMLAFKVTTPGRRMRQFLVSGAPNYIIPICTLIQFTLCAVWMGTNPPYVDTDA
HSEHGHVIIMCNKGSLTAFYCVLGYLSSLALVSFTVAFLVRNLPDTFNEAKFLTFSMLVF
CSVWVTFFPVYHSRRGKVMVAMEVFSILASSAGLLGCIFVPKCYIILLRPEKNSLTEIRG
RTHF
Download sequence
Identical sequences ENSCPOP00000014515 ENSCPOP00000014515 10141.ENSCPOP00000014515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]