SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014706 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014706
Domain Number 1 Region: 5-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.41e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 145-340
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.35e-32
Family Laminin G-like module 0.0099
Further Details:      
 
Domain Number 3 Region: 698-714,749-909
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.15e-30
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 4 Region: 311-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.18e-30
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 5 Region: 940-1129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.99e-23
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 6 Region: 550-601
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000139
Family Fibrinogen C-terminal domain-like 0.011
Further Details:      
 
Domain Number 7 Region: 521-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000681
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014706   Gene: ENSCPOG00000020022   Transcript: ENSCPOT00000027789
Sequence length 1257
Comment pep:novel scaffold:cavPor3:scaffold_42:1843461:1975757:-1 gene:ENSCPOG00000020022 transcript:ENSCPOT00000027789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADSCDAPLASALPLSSFSSSSELSGSHGPGFARLNRRDEGAGGWTPLVSNKYQWLQIDLG
ERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNWKQYRQEENIKGFPGNTNADSVVHYRL
QPPFEARFLRFLPSAWSPKGRIGMRVEVYGCAYRSEVVYFDGQSVLLHRFDKESVSPIRD
TIALKFKTRQSNGIILYRAGPHGNNFTLELIKGKLVFVLNPGNAPVPPTDAPMNLTLGSL
LDDQHWHSLLLDILGVHVTLTLDKHTYHFHAKESSYMDLNFEISYGGIPTPQGALRFSSK
NFHGCLENLYYNGVDIIELAKKHNAEILTMGNVSFSCPQPEIVPVTFLSARSHLDLPGSP
GEDRISVSFQFQTWNKAGQLLSSEFWHGSGSFVLFLKDGKLKLSLFQPGQSSRTITAGAG
LHDGQWHSVSFSVNSSHVSVAVDGEAAGQPLGTMLIVSGGAYHFGGCPNSSAGRGCESLL
GALQGCLRLISISRRAVDLISVQQGALGSFSDLQIDSCGIVDRCLPSYCEHGSDCSQSWD
TFSCDCQGTGYTGATCHSSVYEQSCEAHKYSGSPSGPYYIDADGSGPLGPCLVYCNMTDL
GWIIDIINHSGLDVIIAKVLNQPHYSHLGLRESVPSLDICQSVPSTNKNTRNEITYICKK
THLNCLSDGTPLSWWVGRTNETHSYWGGSLPGAHKCTCGLEGNCTDSQYHCNCDADRNEW
NSDTTVLAHKEHLPVPGLVMPGTSRPHSAAAHVLGPLLCQGDKSFWNSASFNTETSYLHF
PTFHGELTADVSFFFKTTVSSGVFMENLGITDFIRIELHAPSEVTLSFDVGNGPCEVSVQ
SATPFSDGRWHRVRAERNVKGASLQWTSCARSARPLATRSLQLNSQLFVGGTASRQKGFV
GCMRALQLNGIFLDLEGRATVTPGVEPGCAGHCSSYGHLCHNGGRCRERHRGIACDCAFS
AYDGPFCSQEISAYFETGSSMTYNFQEHYTLSKNTSSLTASSLQKDITFSRETITLSFQT
TGTPSSLLYVSSFYEEYLSVILAKNGSLQIRYKLDSHQEPDAFNFDFKNMADGHLHQLKI
NRKEAVVSVEVNQSAKREVILSSGTEFNAVKSLVLGKVLESHSKLQCKNSLKGLDIQRTG
VLLTQTLQGCYVLMARSHRSHVPGLLDLGHAPRSSATTAQPRAPETPTLGAGPFNKQRGA
VPAEAGEPLLPARSDSGVIGGVIAVVIFILLCVVAIGLHAYQQRKLPQKSESKVSAN
Download sequence
Identical sequences ENSCPOP00000014706 10141.ENSCPOP00000014706 ENSCPOP00000014706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]