SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014740 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014740
Domain Number 1 Region: 2-472
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.49e-77
Family L-arabinose binding protein-like 0.000053
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014740
Domain Number - Region: 481-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014740   Gene: ENSCPOG00000026858   Transcript: ENSCPOT00000023320
Sequence length 812
Comment pep:novel scaffold:cavPor3:scaffold_86:6708314:6723249:1 gene:ENSCPOG00000026858 transcript:ENSCPOT00000023320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDVLIGAVTPMHAVMHQTHVSFQQPPEQPLCTQFKSHFFLNALGLLFAVAESREDPSFL
PNITVGLQIHDSCISGTQALHSTLALLSNQLRPTPNFSCGPQRLLLGVIGGMTSPESQPM
AELLSVYRVPQISHGSQHPQFSNHHRFPSFLRTVPSSAHQPWLLARLLDHFKWTWVGLVG
SDNGNFEQLDQQAQGGCVAFSSKISGPNSSIQRAATHITSTPTARVIICDCYHFHFQLLA
EALEDWVVGRTWVFSTSFLYSPSVLDPRAQRLLDGSLNLAISAGTMPGLQGFLLALRPAA
HPDSSLLRKLWEQLHQCKWPGLVAFPQSYREGAPMCTGLENMTVAHLAPFRLSDLSATYQ
AYLAARALLVAYQTLTSCSAGEGPFVGGTCAQAQAARPDWNLLYYTQNVRFTTSAQEEIF
FTREREMLTTFDIQNIKVLEAQRGQKGTVGHFNFRAPAGKELEIQEAAVTWAGGGSQVPS
SVCNEKCPVGTRKSALHEKSKCCYECLPCPRGEIAPAPDSAVCKKCPGDQWPGVGKSQCI
PRTLDFLSYHEPLGMVLATCAALLFLLTLAVLGIFIRHHHSPIVRANNRRLSYLLLAALA
LCFLCPFLFLGHPGIITCAMRQAAFGVTFTVCVSTVLAKTVVVVAAFHTTQPGIHISKWV
GSRLPSTIPSVCSLIQAALCTLWVAQWPPRPMNSTEPGASITVKCDGGSVALFYTMLGYL
ALLALVSLLVAFPARRLPDTFNEAKHITISMLVCSCVWVSFIPAHVSTQGKDTVAVEVFA
ILASAAGLMCCLFFPKCYIILLHPERNTRGQV
Download sequence
Identical sequences 10141.ENSCPOP00000014740 ENSCPOP00000014740 ENSCPOP00000014740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]