SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014761 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014761
Domain Number 1 Region: 136-247
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-31
Family C-type lectin domain 0.00000647
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014761
Domain Number - Region: 103-132
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000575
Family Triple coiled coil domain of C-type lectins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014761   Gene: ENSCPOG00000027540   Transcript: ENSCPOT00000019821
Sequence length 249
Comment pep:known scaffold:cavPor3:scaffold_62:10616908:10619362:1 gene:ENSCPOG00000027540 transcript:ENSCPOT00000019821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFPWLLVLLLCVVRDCCSEVKACEDAQKTCSVVVCGIPVTNGTPGRDGRDGPKGEKGD
PGQGLRGLQGPPGKLGPPGKTGGSGPSGSKGQKGERGDSSVAESKLANLEREIRTLKSEL
NSIRKLQGFSLGKKSGKKFYVTNGEKMSFAKVKGLCAELGGTVATPRNAEENKAVQEVAK
DNVFLGITDEVTEGQFMYVTGGRLAYSNWKKDEPNDYGTGEDCVILKTDGTWNDITCTAA
FLAVCEFSA
Download sequence
Identical sequences 10141.ENSCPOP00000014761 ENSCPOP00000014761 XP_003466202.1.53824 XP_013004092.1.53824 XP_013004094.1.53824 ENSCPOP00000014761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]