SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014831 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014831
Domain Number 1 Region: 1509-1621
Classification Level Classification E-value
Superfamily C-type lectin-like 2.59e-47
Family Noncollagenous (NC1) domain of collagen IV 0.000000574
Further Details:      
 
Domain Number 2 Region: 1397-1506
Classification Level Classification E-value
Superfamily C-type lectin-like 2.26e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014831   Gene: ENSCPOG00000026271   Transcript: ENSCPOT00000022220
Sequence length 1622
Comment pep:known scaffold:cavPor3:scaffold_5:15995393:16036963:1 gene:ENSCPOG00000026271 transcript:ENSCPOT00000022220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGERGLPGLQGVIGFPGMQGPEGPHGPPGLKGDTGEPGLPGTKGTRGPPGASGYPGNPGL
PGIPGQDGPPGPPGIPGCNGTKGDRGPAGPPGLPGFTGNPGPPGLPGMKGDPGEILGHVP
GMLLKGERGFPGPQGMPGPPGQPGLQGPMGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGP
KGDKGEQGVSGPPGVPGQAQVQQKGDFAPTGEKGQKGEPGFQGVPGVGEKGEPGKPGPRG
KPGKDGEKGERGSPGFPGDSGYPGLPGQPGLKGEKGEAGLPGPPGTVIGTGPLGEKGERG
YPGAPGLKGEPGPKGYPGIQGQPGPPGLPIPGQTGPPGFPGDRGEKGDQGLPGVSLPGPK
GKDGIPGPPGPPGPPGQPGYTNGIVECQPGPPGDQGPPGAPGQQGLTGEIGEKGQKGDSC
LICDTEGLRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGVEGVPGPKGAPGLIGQPGAK
GEPGEIIFDSRLKGDKGAPGFPGQPGLPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGP
PGEVGFPGSRGDIGPPGLPGFGPIGPIGDKGQIGFPGSPGVPGPPGPKGEAGRTFPLPGP
PGADGLPGSPGFPGPQGDRGFPGTPGRPGLPGEKGAMGQPGIGFPGPPGPKGVDGIPGDM
GPPGIPGRPGFNGLPGSPGAPGQKGEPGVGLPGLKGLPGVPGIPGTPGEKGSIGGPGVPG
EHGAIGPPGLQGIRGDPGPPGVQGPAGPPGAPGLGPPGAMGPPGGPGLPGSSGPPGVKGE
KGFPGFPGLDMPGPKGDKGAQGLPGLTGQSGMPGPPGQQGTPGLPGFQGPKGEMGIMGTP
GQPGAPGPVGAPGFPGEKGEHGFPGSSGPRGDPGFKGEKGDVGLPGKPGSMDPVDMGTMK
GQKGDQGEKGQTGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGISGTPGAPGLP
GPKGAVGGMGLPGTPGEKGVPGIPGQQGFPGSPGEKGAKGEKGQAGLPGIGIPGRPGDKG
DQGLAGFPGIPGEKGEKGSAGMPGVPGSPGPKGAPGSIGYQGSPGLPGEKGDKGLPGLDG
IPGVKGEAGLPGTPGLIGPTGQKGEPGSDGIPGSAGEKGEPGLPGRGIPGFQGAKGDKGS
KGEVGFPGLAGSPGIPGPKGEQGFMGPPGPQGQPGIPGAPGRAVEGPKGDRGPQGQPGVP
GLPGPMGPAGLPGLDGRKGEKGNPGWPGPPGVPGPKGDPGFQGLPGIGGSPGITGSKGDM
GLPGVPGFQGQKGLPGIQGLKGDQGDQGVPGPKGLPGPPGPPGPYDVIKGDPGLPGPEGP
PGLKGLQGPPGPKGQQGVTGSAGIPGPPGSPGYDGAPGQKGETGPFGPPGPRGFPGPPGP
DGLPGSMGPPGTPSVDHGFLVTRHSQTTEDPLCPPGTKVLYHGYSLLYVQGNERAHGQDL
GTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGENIRPFISR
CAVCEAPAMVMAVHSQTIQIPQCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEE
FRSAPFIECHGRGTCNYYANAYSFWLATIERNEMFKKPTPSTLKAGELRTHVSRCQVCMR
RT
Download sequence
Identical sequences ENSCPOP00000014831 ENSCPOP00000014831 10141.ENSCPOP00000014831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]