SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014968 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014968
Domain Number 1 Region: 127-321
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.87e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 748-858
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-38
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 3 Region: 444-546
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 4 Region: 593-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 328-437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-36
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 6 Region: 884-977
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 7 Region: 551-589,704-750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000596
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014968   Gene: ENSCPOG00000019973   Transcript: ENSCPOT00000024436
Sequence length 988
Comment pep:known scaffold:cavPor3:scaffold_1:58979608:59018552:1 gene:ENSCPOG00000019973 transcript:ENSCPOT00000024436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVARPPLLGLLLLLLARPGRPLDLADYTYDLGEEDAPEPINYKDPCKAAAFLGDIALD
EEDLRAFRVLQAANLRQHTARRSSINKTAVPGNSSAPDCQSSSVQPPRETPGRWRGRPRS
RRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVF
TYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVR
ENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPP
IGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGE
KIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRS
SSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQ
SFEIERHDSCAYDYLEVRDGHSETSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKA
GFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKL
NGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTAD
SKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDC
VNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAIS
STPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGNRMF
LRFYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEE
GYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKF
HSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences ENSCPOP00000014968 10141.ENSCPOP00000014968 XP_005008160.1.53824 ENSCPOP00000014968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]