SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015135 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015135
Domain Number 1 Region: 127-237
Classification Level Classification E-value
Superfamily C-type lectin-like 7.22e-41
Family Link domain 0.0015
Further Details:      
 
Domain Number 2 Region: 239-321
Classification Level Classification E-value
Superfamily C-type lectin-like 2.92e-17
Family Link domain 0.0031
Further Details:      
 
Domain Number 3 Region: 13-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000115
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015135   Gene: ENSCPOG00000023683   Transcript: ENSCPOT00000026781
Sequence length 322
Comment pep:known scaffold:cavPor3:scaffold_72:8480488:8483793:-1 gene:ENSCPOG00000023683 transcript:ENSCPOT00000026781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVVHVLGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAF
IDVFVALGPQHRAFGSYRGRAELQNDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGM
VKLDLEGVVFPYHPRGGRYKLTFEEAKRACAEQDGILASAEQLHAAWRDGLDWCNAGWLR
DGSVQYPVSRPREPCGGLGGPGGVRNYGYRHNARERYDAFCFTSNLPGRVFFLKPLRPVP
FAGAARACAARGANVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGSGLAC
AAFGFPDASRRLFGVYLYKGHH
Download sequence
Identical sequences 10141.ENSCPOP00000015135 ENSCPOP00000015135 ENSCPOP00000015135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]