SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015548 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015548
Domain Number 1 Region: 217-355
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-24
Family C-type lectin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015548   Gene: ENSCPOG00000024787   Transcript: ENSCPOT00000023479
Sequence length 365
Comment pep:novel scaffold:cavPor3:scaffold_27:15967557:15974257:-1 gene:ENSCPOG00000024787 transcript:ENSCPOT00000023479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAVTYADLRFVKAPLKKSLSCGLGPEAEAYEDGDAYGELTYENVQVPSAPGGASGAPS
GVGDQAGVHSEPTAASWSPVTSPGVPWTLPCPATCLQYVLLGLLLTCLLLAVATICLGVR
YLQASQQLQHTKRVLEATNSSQWQQLRQKLTQLGQKEGDLQESRKALAQSQEELQEERRL
HLAAQEQLRTCQVDGEKTKETLRGEEKQREALERRLSTTKDALRRFFTCPSEDTCCPMGW
TLHERRCFYFSATKKTWEESKNHCTSLSSTLATFGLTYYYQRLPSSYSKLLSGSVSESYW
IGLHSQKARQSWSEDLKSRYYYQSSDCVILQKEWLRLWQSDKCATHLPWICELAAFRFPD
GYSLH
Download sequence
Identical sequences ENSCPOP00000015548 ENSCPOP00000015548 XP_013009012.1.53824 10141.ENSCPOP00000015548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]