SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015601 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000015601
Domain Number - Region: 13-32,116-159
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0714
Family Growth factor receptor domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015601   Gene: ENSCPOG00000020202   Transcript: ENSCPOT00000019501
Sequence length 231
Comment pep:known scaffold:cavPor3:scaffold_369:179883:182613:1 gene:ENSCPOG00000020202 transcript:ENSCPOT00000019501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLCLGMTAALARGCLHCHNNFSEKFSFYRHHVNLKSWWVGDIPVSGALLTDWRQDTM
RELHLAVPAEITRENLEQVARTVFRKMDQLYQGKMYFPGYFPNELRAIFREQVHLIQNAV
IKSHIDCQRHCGIYQYQTISCHNCSDSHVVCFGYNCESSAQWERAVRGLLLYISNWHKQD
TRMRPSSSCISSAGTRRTTPAFLIAPSISCLEPQRLANLTLENASECLTLY
Download sequence
Identical sequences ENSCPOP00000015601 10141.ENSCPOP00000015601 ENSCPOP00000015601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]