SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016148 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016148
Domain Number 1 Region: 1779-2025
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.66e-55
Family Ankyrin repeat 0.0000000645
Further Details:      
 
Domain Number 2 Region: 801-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.0047
Further Details:      
 
Domain Number 3 Region: 1112-1251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000228
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number 4 Region: 573-702
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000889
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 391-514
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000127
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 510-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000375
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 188-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000132
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 1083-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000292
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 161-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000005
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 10 Region: 928-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000125
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1248-1299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1467-1500
Classification Level Classification E-value
Superfamily Notch domain 0.0000000785
Family Notch domain 0.0035
Further Details:      
 
Domain Number 13 Region: 1338-1375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000822
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 738-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000166
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 314-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000175
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 16 Region: 124-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000212
Family EGF-type module 0.013
Further Details:      
 
Domain Number 17 Region: 965-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 1004-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000401
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 48-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000607
Family EGF-type module 0.068
Further Details:      
 
Domain Number 20 Region: 356-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000607
Family EGF-type module 0.025
Further Details:      
 
Domain Number 21 Region: 1388-1420
Classification Level Classification E-value
Superfamily Notch domain 0.00000112
Family Notch domain 0.0011
Further Details:      
 
Domain Number 22 Region: 1055-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.027
Further Details:      
 
Domain Number 23 Region: 1428-1460
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 24 Region: 777-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000054
Family EGF-type module 0.028
Further Details:      
 
Domain Number 25 Region: 695-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 83-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000228
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016148
Domain Number - Region: 1287-1327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00357
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016148   Gene: ENSCPOG00000022014   Transcript: ENSCPOT00000026107
Sequence length 2289
Comment pep:known scaffold:cavPor3:scaffold_168:1401609:1432116:-1 gene:ENSCPOG00000022014 transcript:ENSCPOT00000026107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGGGGQGPREAQRWRSSPPSPGALPGLLLLLPLLAGLGAAGAPPCGLDGSPCANGGRCTQ
LPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDC
SLPDPCLSSPCAHGARCSVASDGRFVCSCPPGYQGRSCRSDVDECRVGRPCRHGGTCLNT
PGSFHCQCPGGFAGPLCESPAVPCAPSPCRNGGTCRQSGELTYDCACLPGFEGQHCEVNV
DDCPGHQCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGS
HSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVS
NPCHEDAICDTNPVNGRAICTCPAGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLC
QCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSP
CVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGF
EGTLCERNVDDCSPDPCHHGRCVDGIASFTCACAPGYTGTRCESQVDECRSQPCRHGGKC
LDLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCRPGFIGPLCNVE
INECASSPCGEGGSCLDVENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGVCHDAPGGFR
CVCEPGWSGPRCSQSLARDTCESQPCRGGGTCVSDGTGFRCSCPPGVQGRQCELLSPCTP
NPCEHGGRCEAAPGQPVVCSCPLGWQGPRCQQDVDECADPAACGPHGTCTNLAGSFSCTC
HGGYTGPSCDKDIDDCNPNPCLNGGSCEDGVGSFSCSCLPGFAGPRCALDVDECASSPCG
PGTCTDHVASFACSCPPGYGGLHCEKDLPDCSPRLLFHGGTCVDRVNSFSCLCRPGYTGV
HCQYEADPCLSRPCLNGGVCSATHPGFRCACQEGFAGSQCQSLVDWCSQAPCKNGGRCVQ
TGAYCLCRPGWSGRLCDIRSLPCAEAAAQMGVRLEHLCQAGGQCVDKGGSYSCVCPEGRT
GSHCEQEADPCMARPCQHGGTCRGYMGGYVCECPAGYSGDNCEDDVDECASQPCQHGGSC
IDLVARYLCSCPPGTLGSHCEVNEDDCGPSPDLGLRCLHNGTCVDLVGGFRCNCPPGYTG
LHCEADINECRPGACHAAHTQDCLQEPGGHFRCLCHAGFTGPRCQTALSPCESQPCQNAG
QCRPSPGPGGVLTFTCHCVQPFWGPRCEHVARTCRELQCLPGVPCQQTPRGPRCACPPGV
SGLSCRSKALPPGSTNASCAAAPCLHGGSCRPAPLAPFFRCGCAPGWTGPRCETSVAVSA
PEVAEEPWCPRAACQAKRGNRRCDRECNIRACGWDGGDCSLSVDDPWRQCEALQCWRLFN
NSRCDPACSSPACLYDNFDCHGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLMPPEELLRSSADFLQRLSAILRTSLRFRLDANGKAMVFPYHR
PSSGSEARTRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSVVERL
DFPYPLRDVRGEPLELPEPSVPMLPLLAAGAVFLLVILVLGVMVARRKREHSTLWFPEGF
ALHKDVAGGHKGRREPVGQDALGMKSMAKGETLMGEMASDWMDTDCPEAKRLKVEEPGVG
AEEPVDCRQWTQHHLVAADIRVAPAMALTPPQGDADVEGVDVNVRGPDGFTPLMLASFCG
GALESVPAEEEEAEDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHYANREITDHLDRLPRDVAQERLHQDIVRLLDQPSAFLPGLKTASSG
PKKSRRPPGKKLTLACPGPLAESSVTLSPVDSLDSPRAFGGPPASPGSFPIEGSYAAAAA
TAVSLAQLGGPGRSGALGRTPRGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAAG
PQLLNPGTPVSPQERPPPYLAAPGHGEEYPVAGTRGSPPKARFLRVPSEHPYLTPSPESP
EHWASPSPPSLSDWSDSTPSPATAPGATATAAAALPSQPHPLSVQGSLAQAQSQLGAQPE
GTPKRQVLA
Download sequence
Identical sequences 10141.ENSCPOP00000016148 ENSCPOP00000016148 ENSCPOP00000016148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]