SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016308 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016308
Domain Number 1 Region: 142-243
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-33
Family Link domain 0.0021
Further Details:      
 
Domain Number 2 Region: 245-328
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-24
Family Link domain 0.0021
Further Details:      
 
Domain Number 3 Region: 44-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000679
Family I set domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016308   Gene: ENSCPOG00000012633   Transcript: ENSCPOT00000012754
Sequence length 330
Comment pep:known scaffold:cavPor3:scaffold_10:17182547:17184111:1 gene:ENSCPOG00000012633 transcript:ENSCPOT00000012754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRLTLYDLCPFLLPWLLTISHRALGDSAPHPSPHYLLPPIHEVIHSRRGATATLPCVL
GASPPSYKVRWSKIEPGELRETPILITNGLHARGYGPLGGRARLRRGHRLDASLVLADVH
LEDEGRYRCELINGMEDESVALTLRLEGVVFPYQPSRGRYQFNYFEAKRACEEQDGRLAT
YGQLYQAWTEGLDWCNAGWLLEGSVRYPVLTAIRSYGPRDRARDRYDAFCFTSALAGQVF
FVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPR
CGGLPDPGVRSFGFPGPQQAAYGTYCYTGT
Download sequence
Identical sequences ENSCPOP00000016308 ENSCPOP00000016308 10141.ENSCPOP00000016308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]