SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016431 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016431
Domain Number 1 Region: 180-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000308
Family Growth factor receptor domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016431
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016431   Gene: ENSCPOG00000027432   Transcript: ENSCPOT00000027227
Sequence length 353
Comment pep:known scaffold:cavPor3:scaffold_184:792494:798015:-1 gene:ENSCPOG00000027432 transcript:ENSCPOT00000027227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPSLRFALVVLLPLLVRTPVLGTAQKTAPCQRCRTLVDKFYQGMANTAKKNFGGGNTAW
EEKTLSKYEFSEIRLLEIMEGLCDSSDFECNQLLEQQEESLEDWWLRLKKKHPDLFKWFC
VQTLEVCCSPGTYGPDCRACQGGSERPCSGNGHCNGDGSREGDGSCQCHQGYKGPLCADC
MDGYFQSLKTETHSSCTACDEACRTCSGPTNRDCVECEAGWTRVEDACVDVDECAADTPP
CNDTQYCDNVAGSYACEECDSTCVGCTGKGPANCKECVPGYLKENGQCTDIDECSLAEKV
CTRKNENCYNTLGSFVCVCPDGFEETEDACVPPAEGAETAGENPTQLPPREDL
Download sequence
Identical sequences 10141.ENSCPOP00000016431 XP_003461640.1.53824 ENSCPOP00000016431 ENSCPOP00000016431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]