SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016432 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000016432
Domain Number - Region: 281-364
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016432   Gene: ENSCPOG00000027503   Transcript: ENSCPOT00000026709
Sequence length 2199
Comment pep:known scaffold:cavPor3:scaffold_53:9537016:9549518:-1 gene:ENSCPOG00000027503 transcript:ENSCPOT00000026709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAGAALQRSPVWGLLCCCFLCGGALGSPRPLPSLPPLPAQTEPALEPVWRPLPGAGAAL
AFLYSGDAHQLVGANCSEPYEALGVEARAGLPPVLQGAAGTLAQAANFLNMLLQANDIRE
SSVEEDVEWYQALVRSVAEGDPRAYRALLTFNPPPGASHLPLALQATRMGAETLLQDLSG
NRMQEESPAEDLDSFGLQKRVLTNDLRSLNSPKWPQGDGYVGDTQQVRLSPPFLDCQEGQ
LRPGWLVTLSATFYGLKPDLSPEVRGRVQMDIDLQTVDINQCASGPSWFSNTHLCDLNST
QCVPLEGQGFILGQYLCRCRPGFFGASGSGALEEDIAQTTGEGRLLRCQPCPEGCTGCVD
DTPCLVQEALALRAAVLACQACCMLAVFLSMVISYHRRWSKRIRASGVVLLEAILFGSLL
LYFPVFILYFKPSVFRCIALRWVRLLGFVTVYGTITLKLYRVLQLFLSRSAQRGPHLGSG
QLLRRLALLLLAVLGFLAVWTAGVLERGQLMPLVIRGHTPTGRHFFLCHHDLWDYIMVVA
EVLLLCWGSFLCYATRAVPSAFHEPRYMSIALHNELLLSAAFHTARFMLVPSLHPDWTLV
LFFLHTHSTVTATLALIFLPKFQKPGVQPHEEILDEVYEDELELQRSGSYLNSSIASAWS
GHSLDPGDIRDELKKLYTQLEVRKTKEMAANNPHLPKKRGSSRQGLGRSFVRYLAEFPEA
LARQHSRGSSSLGCSSLPGSSRRRLLSSGQQDAEGSPALANSHSTCDQHQEQEPALLGSV
LQRNLSRKALRLDGQEPATTEGPLALGFRSASAHNLTVSERLPRARPSSLQKSLSVVADT
REKALLLASQAYLEETYWQAKERQERKRAEVAMASSLRRPLTRRPERAWGVPLSAPPSPA
KSSSMDSSQATGGPQDEGGMRSPHPPIRHRVSSPILGLPGASLAEPRMLSPSSALAPVPI
PALAPLPGPPQSPSLLTYICPWENTELPVKKENTAQKGISGLEPGSHSPAPARAKLWRAL
SVAVEKRASRDNDVDTKDGRPQGEAGEGDEDRPKIFSKSHSLKTPMQEGSMRSLGLAIKA
LTRSRSTYREKEGCEDGHEMEKGRATAPWSPRPGRPRAVGKQVALASCDDEESLQNQQNA
HTSRMLQVCHQEGGREQDRGRKMSQGLREHRVERVGKTGLATLRQVFGDKSAEQAKEVPV
GRQEPLQSGLQLPGSADRRVAEACPWEVAESDVGGLDNSSKAQICPWEVSEGSPSGQQPG
DTQEDKRTATGKSELRGAAAVTARKRPERLVRSQEAVCPWEGTDPRAVGSVDGKKPNKPQ
GEAPGTEARSPQPAKAELCPWEVDEGDQGTPPPGERELPREGQGPPKKAALWRGQKLDGG
LESLCPWESTDFRGPLAVPLQASGSLGSSITEVCPWEAGDTTPDPRKADVCPWEVSEGLE
DGTSGQAAKGHSEKAKEKMSAKRETRDVTSKDRPEVQASKQESVCPWESTDPGSIPPPPG
AQNSERPQVISQSSGSMGSRAAEVCPWEVDDALMAEKAQICPWEEGAGAREKEDPDRGTE
APRKSPNAAVGEACAGSRPRETQEPGRPGVQEEVVCPQETSGPGDCQHEDALDTDRPGVG
LQDLGSVGCRPTEVCLWEVQEAATSNKAKICPWEVNEGDTRKGSEQDTGSTPAPAGCWEE
TLEQGGLPALGRGVANLEAKLHPQQEAICPWEAQDLESSALDTKVSDLSLAVSAEATEKG
TLKPDPQMGFPPEHKSQGKAPAWKADLAIDGEEQARRKSQSVCPRDNMVLEDSLSHPASP
HPAQREASFQAPSSAGASAAHLCPWEASDPDVCQADSSAKAEVCPWEAMEKVPEKGASKQ
DGKGDPQEGTGRVLERPEPPGVAALETPEMADGRKLEAVCPGDRRDCGGLSPQLALGTSD
VCRNRSEAAGHVRTRVAEMCPWEVEEVSSAKKAEVCPGELGPGAAREGALAQEVAGGSQG
QGEAFLPRTGSARAEGDSSEVAATLRLTLRQEQDTVSLREGAGSEGLVPPGDALDTDYEN
GSCRGAGSVGTQIAELCQWEVTDPEGNKIRGTMADICPWEETQAPSEEPGLLALTVAQAE
NVPRAPEKSLCLPISFFPESKSSRPEGTKGNKAAGAGPQEDVRELQGASVPGPRTSAAPE
LSLQEAEAQKSSPLAEDRGQAASETQGDTAGPPPACPWD
Download sequence
Identical sequences 10141.ENSCPOP00000016432 ENSCPOP00000016432 XP_003467115.1.53824 ENSCPOP00000016432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]