SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016577 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016577
Domain Number 1 Region: 30-157
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-32
Family C-type lectin domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016577   Gene: ENSCPOG00000025637   Transcript: ENSCPOT00000026794
Sequence length 158
Comment pep:known scaffold:cavPor3:scaffold_2:44395998:44408920:-1 gene:ENSCPOG00000025637 transcript:ENSCPOT00000026794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALGHFYVDLNYDCLAFTSIMCTDIWRPSCAPGWFYYKSNCYGYFWRPRTWFDAEIECQS
YGYGTHLASVLSHKEASVISKYISGYQRNQPVWIGLHDPQQKELWQWLDGTPYLKGFLNN
GTSGEHKHCAEMSYKKKFLAWNKNDCNKLQHFLCKYQP
Download sequence
Identical sequences ENSCPOP00000014951 ENSCPOP00000016577 10141.ENSCPOP00000014951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]