SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016628 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016628
Domain Number 1 Region: 1-400
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-94
Family L-arabinose binding protein-like 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016628
Domain Number - Region: 402-467,530-546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00126
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016628   Gene: ENSCPOG00000027337   Transcript: ENSCPOT00000024565
Sequence length 755
Comment pep:novel scaffold:cavPor3:scaffold_42:13877598:13885886:1 gene:ENSCPOG00000027337 transcript:ENSCPOT00000024565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQYVLAFYFAIEEINKDSQLLPNVTLGFHVYNAIASDHFALWSTLLWIALPNYNCQTHRK
FAAVIAGTSAAFSAETGTILELYKFPQVTYGPFDPILNDKHQYPSVYQMALNDRTLVHAM
ISLLLHFGWTWVAIFVSNDVKGEHFLGDLKAEILKKGICVALTEKLPVTKIIKIRVSSAN
VHILYGEVASLINVDIAAEFFLTTGKVWIMTAKWDIVVYETDHMLHSFHGSFSFSPHKGE
VPGFRQFLQTIKPSQYPEGSQCGRIGVCPPNTSLEFMPGNIDLMTLSDSSYFIYNAVYAL
AHVLHKVLLEKAEFGSSEDAEEPGLLPWQLHPHLKKMEFTNSAGYSKSLDEERQHVAQYD
IQNTLNFPGGLRVLVNVGKFFFKRPHGQSLVINDELIEWPVGFTETPQSVCSQSCGPGFS
KIPQEGRPVCCFTCIFCPERHISNQTDAEQCTQCPKHEYSNRNRDHCLPKILDFLSFEDP
LGMALTQIALSFSLITAVILAIFVKHRDTPIVKANNRTLSYTLLISLLLCFLCSLLFIGR
PNTGTCILQQMTFGLVFTVAVSSVLAKTITVVLAFKVTGPGRRMRHLLVSGAPNYIIPIC
TLIQLTICGFWMGTNPPYIDTDAHSEHGHIIIVCNKGSLTAFYCVLGYLGSLALLSFTVA
FLAKNLPDTFNEAKFLTFSMLVFCSVWVTFLPVYHSSKGKVMVAMEVFSILASSAGLLGC
IFLPKCYVILIRSENNTLTGLKIAVYNYKQQCYCR
Download sequence
Identical sequences 10141.ENSCPOP00000016628 ENSCPOP00000016628 ENSCPOP00000016628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]