SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016629 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016629
Domain Number 1 Region: 2-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-89
Family L-arabinose binding protein-like 0.000000193
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016629
Domain Number - Region: 350-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0115
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016629   Gene: ENSCPOG00000001886   Transcript: ENSCPOT00000024523
Sequence length 751
Comment pep:known scaffold:cavPor3:scaffold_16:34896137:35396515:1 gene:ENSCPOG00000001886 transcript:ENSCPOT00000024523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYG
EKGVESFTQISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDED
IKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFT
SRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFV
IDAVYAMAHALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRSVNFNGSAGTPVMFNKNG
DAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQ
RKKTQKGAPCCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQNIPIIKLEWHSPWA
VIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPD
VAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLIS
VQLLGVFIWFGVDPPNIIVDYDEHKTMNPEQARGILKCDITDLQIICSLGYSILLMVTCT
VYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNL
SASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTE
LCENVDPNNCIPPVRKSVQKSVTWYTIPPTV
Download sequence
Identical sequences ENSCPOP00000016629 10141.ENSCPOP00000016629 ENSCPOP00000016629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]