SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016778 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000016778
Domain Number - Region: 290-387
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00549
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016778   Gene: ENSCPOG00000001565   Transcript: ENSCPOT00000027231
Sequence length 1178
Comment pep:known scaffold:cavPor3:scaffold_109:1186021:1188068:-1 gene:ENSCPOG00000001565 transcript:ENSCPOT00000027231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGQSDAPRERTPRAKQHAPQAARASAPDPSAPWSRSADGTILAQKLAEEVPVDVASYLY
TGDSHQLKRANCSGRYELAGLPGKSPALASSHPSLHGALDTLTHAINFLNMMLQSNKSRE
QNLQDDLEWYQALVRSLLEGEPSISRAAITFSTESLSGPAQQVFLQATRGESRILLQDLS
SSAHHLANATLETEWFHGLRRKWRPHLHRRGSNQGARGLGHSWRRRDGFSGDKSHVKWSP
PYLECENGSYKPGWLVTLSAAFYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGT
HKCHLNNSECMPIKGLGFVLGAYECICKAGFYHPRVLVNNFHRADPDHQSSGSARGVSEE
THVCLPCREGCPYCADDRPCFVQEDKYLRLAIICFQALCMLLDFVSMLVVYHFRKAKSIR
ASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWVRLLGFATVYGTITLKLHRVLK
VFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLIGWTSSVCQNLEREISLIGQGQTSDHL
IFNMCLIDRWDYMTAVAEFLFLLRGVHLCYAVRTVPSAFHEPRYMAVALHNELIISAVFH
TIRFVLAARLQSDWMLMLYFAHTHLTVTVTIGLLLIPKFSHSSNNPRDDIATEAYEDELD
MGRSGSYLNSSINSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKK
GLGRSIMRRITEIPETVSRQCSKEDKDLADHSTTKSAALVRKNPPESSGNTGRPKEESLK
NRVFSLKKSHSTYDHVRDQTEESSSLPTESQEEETTENSTLESLSSKKLMQKLKEDSEAE
STESVPLVCKSASAHNLSSEKKPGHPRTSMLQKSLSVIASAKEKTLGLAGKTQASSAEER
AKSQKAPPKDKETNRKYSNSDNAETKDSAPQNSNHVEEPRRPQKSGIMKQQRINPATANS
DLSPGTTQMKDNFDIGEVCPWEMYDLTPGPVPSESKSQKHVSIAASEMEKNPTFSLKEKS
YHKSKSPEGYQQFNQKGIDKAEVCPWENQGQSLFEEEKHLISKTPVLPGRVKDENGGPHH
TPNVSAGQYEELTPKIIASKVDNENLNQMGDQETKTLPSVENVPGFYNSSNNFQQSLISR
AEVCPWEFETPEQPNAEKSVALPASSALSANKIAGPQK
Download sequence
Identical sequences 10141.ENSCPOP00000001414 ENSCPOP00000001414 ENSCPOP00000016778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]