SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016881 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016881
Domain Number 1 Region: 114-161
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000144
Family Elafin-like 0.002
Further Details:      
 
Domain Number 2 Region: 722-807
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000614
Family Fibronectin type III 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016881
Domain Number - Region: 510-556,916-948
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000129
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 269-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000984
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 310-383
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00252
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number - Region: 395-445
Classification Level Classification E-value
Superfamily SEA domain 0.0602
Family SEA domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016881   Gene: ENSCPOG00000023566   Transcript: ENSCPOT00000025769
Sequence length 1337
Comment pep:known scaffold:cavPor3:scaffold_90:2402006:2444131:1 gene:ENSCPOG00000023566 transcript:ENSCPOT00000025769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSRMLGLALLALAGTTTVGLSWASGFTETGLSLLSYQLCSYQETRTVQRLEAVQTSHVT
HVACGGWILWRWCPKTIYRTQYLTVEVPESRNITDCCKGYEQLGLYCVLPLNWSMEFTSR
PGVCPTANPETPISPCSSDNDCPGLQKCCPRPEGHHCVAPVSQDAGAVAEGRPTSWYNVT
VRVKMDFTDLSRVDPELQNHTRLLCSLVASALQPLDSSVHYLDSASGGPSSTVSRLLLGL
PRPLVVVNVSTVLDDIPRRVCEVTSIQVQDVDECAHRALHACSMGQQCLNLEGSYRCVSA
EDPTSSPQPLNHTGEDCPPILDHVALNVTSSSFQVSWSVDPPRSRDFHVQVFRGEQLLQS
AWTSGLALQVSGLDAGELYVVRTSYQGCSANISTMLTVKTDARVFEVIIRITNHNLTEQL
LDGGSEERRTFSRQLLREVENSFPPAVSELHRMGKLRLEITSLQAGSVVATLRVMVLDPE
SPVGVSTLAPMLQLLRASTMFQIDPQGSRVQDRDECAHASEHDCSPAARCVNLEGSYTCQ
CHTARDASPTRPGRACEGDVVSPTGRGLSAALGVTALVLTTRNTALVPEPPTLSPNPRNL
ECTPTAAQVPTPGPLPKRGADGTVGQHRNSGGPRPSPGSSWGTTDGPVHSRGQLLGNITT
EPPTLPAPTSSPTGHVEWHPSLPTQGTPLQSTTLWQEDPGPSASQGSLTVPTTVALETPA
CAPVPIRKVTVSNVTSTGFHLMWEADVTLRPTFHLSATAPKGPAVALETREHNAKLSGLE
PGVSYLVELTAKACGEEGAGTRLKVRTAAQKLSGKVRIANVRFSESFRNASSTEYRAFVD
LFSRTVRDSLPATLRQHMDTGGIRMSITCVTNGSIVVEFDLLITVAVDVGVVSATFLDAL
GNMSQLEVVRNDTFIWDYDECGRGEDDCVPGTSCHNTLGTFTCSCEGGAPDSRVEYSGRA
CAGGSPDSFTLTPSPEHRPAGAETSAALPPGTNPEPQGTQPRLNLTGAVRVLCEMERVGI
AIQKHFLQQELIPESSLYLGQPACNASVSNDSHVLLAVGWGECGTLVQSNKTSTVVKTVL
RNDRSPDGIIHHPTILSPIRCIFRNDLLTSLGYTPKWGVYTVMEDLHGAGTFVTEMQLFV
GDSPIPQNYSVSASDEVKVQVGLHRQKSSLKVVLVRCWATPSRDAQDPVTFGFINNSCPV
PNTYTSVIQNGDSSKAQFKLRIFSFINNSIVYLHCKLRVCMESPGATCKINCNDFRVLRS
RDGARMLEVSWGPLLRSAVSPGTRPHLTTSYVALIVVTALVVVAGAVALLILRYQRTTGK
YSFRMQPDNFSYRVFSG
Download sequence
Identical sequences ENSCPOP00000016881 ENSCPOP00000016881 10141.ENSCPOP00000016881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]