SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016968 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016968
Domain Number 1 Region: 3-435
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.03e-101
Family L-arabinose binding protein-like 0.00071
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016968
Domain Number - Region: 446-503,566-573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0487
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016968   Gene: ENSCPOG00000020522   Transcript: ENSCPOT00000020173
Sequence length 784
Comment pep:known scaffold:cavPor3:scaffold_42:15502828:15523923:-1 gene:ENSCPOG00000020522 transcript:ENSCPOT00000020173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPSNYQNYLAFTFAVEEINRNPHILPNVSLGYEFHNFIYSHWRILENSFLLVTGQHEIPN
YTCKKESKCAAVLTENPWDTSAQIGPLLKLYKFPQVYTGSFDPTLSESGQYPSLHQVAQK
DTFLAFAMVSLMLHFRWNWVGLLTTEGHKGFQFLSDVRTEMDRNRVCVAFVKIVASITVS
YFSVMQKHDILTADTSSVNVVVIYYDTDSLNDVSYNIVQNLMTWKIWVTNSQWQADLDGR
NFILDSFHGVLVFSHHYEEISGFKNYVQEATPFKYPDDTYLFMYWYKNFHCSFSESDCAL
ENCIPNASLAWLPSNRFDTTMSDRSYNIYNGVYAVAHALHAMLFVEEQGPSMRNRQNLTM
HFCIRLNPFLKNTQFSNSAGDQVNLNDRRKLDSEYDILNFWNFPEGLRLKVKVGTFSSHA
PHGQKMTLSEDMIEWSTGVTEIPLSVCSQSCSPGFRKSPQEGKAACCFDCIPCANSEITN
ETDMEQCVKCLGHQYANTQRNQCLHKTVTFLAYEDPLGKALAGTALSLTALTAAVLGLFV
KHQNTAIVKANNRTLSYTLLISLLSCFLCSLLFIGQPNTATCTLQQTTFALAFTVAVSTV
LAKTITVVLAFKITAPGKRMRRLLVSGTPNFIIPICSLIQLTLCAVWMGTNTPYIDTDAH
SEHGHIIIVCNKGSLTAFYCVLGYLGSLALLSFTVAFLARNLPDTFNEAKFLTFSMLLFC
SVWVTFLPVYHSSKGKVMVAMEVFSILASAAGLLGCIFVPKCYIILLRPERNSLTGIKKE
PSYH
Download sequence
Identical sequences ENSCPOP00000016968 10141.ENSCPOP00000016968 ENSCPOP00000016968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]