SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017174 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017174
Domain Number 1 Region: 275-401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000643
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 211-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000691
Family EGF-type module 0.007
Further Details:      
 
Domain Number 3 Region: 128-253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000565
Family Growth factor receptor domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017174
Domain Number - Region: 252-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0658
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017174   Gene: ENSCPOG00000024133   Transcript: ENSCPOT00000020022
Sequence length 607
Comment pep:known scaffold:cavPor3:scaffold_58:1496662:1502490:1 gene:ENSCPOG00000024133 transcript:ENSCPOT00000020022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRF
VCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGQYCTEPICLPGCDEQHGFC
DKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHTP
CRNGATCTNTGQGSYTCSCRPGYTGANCELETDECAPSPCRNGGSCTDLENSYTCTCPPG
FYGRVCELSAMTCADGPCFNGGRCTDNPEGGYTCRCPVGYSGFNCEKKMDHCSSAPCSSG
ARCVDLGDAYLCRCQAGFSGRHCEDNVDDCASSPCANGGTCRDGVNDYSCTCPPGYTGRN
CSAPVRRCEHAPCHNGATCHERGLRYACECARGYGGPNCQFLLPEPPGPVVVDLTEKYVE
GQGGPFPWVAVCAGAVLVLVLLLGCAALGVCVRLKLQKHRPAAEPSCRGETETMNNLASC
QREKDVSVSVIGATQIKNTNKKADFHGDQGADKNAFKARYTAVDCNLVQDLKGDEGAIRD
THSKCDTKCQPQSNAGEEKGSAATLRGGEALERKRPESIHSTSKDTKYQSVYVISDERDE
CVIATEV
Download sequence
Identical sequences H0W2I1
10141.ENSCPOP00000017174 ENSCPOP00000017174 ENSCPOP00000017174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]