SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017490 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017490
Domain Number 1 Region: 1-424
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.39e-102
Family L-arabinose binding protein-like 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017490
Domain Number - Region: 435-492,555-560
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0165
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017490   Gene: ENSCPOG00000023021   Transcript: ENSCPOT00000027563
Sequence length 778
Comment pep:known scaffold:cavPor3:scaffold_42:15403233:15423504:-1 gene:ENSCPOG00000023021 transcript:ENSCPOT00000027563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTFAVEEINRNPHILPNVSLGYEFHNFIYSHWRILENSFLLVTGQHEIPNYTCRKENKCV
AVLTENPWDTSAQIGPLLKLYKFPQVYTGSFDPTLSESGQYPLLHQVAQKDTFLAFAMVS
LILHFHWTWVGLLTTEGHKGLQFLSDVRTEMDRNRVCVAFVKIVSSITVSYFSVMQKHDI
LTADTSSVNVVVIYYDTGSLNDVSYNIVQNLMTWKIWVTNSQWQADLDGRNFILDSFHGV
LVFSHHFQEISGFTNYVQEATPFKYPEDTYLFMYWYKNFHCSFSESDCALENCTPNASLA
WLPSNNFDTAMNDRSYNIYNGVYAVAHALHAMLFAEEQGPSMRNRQMKTFSPWQLNPFLK
NTQFSNSAGDQVNLNNRRKLDSEYDILNYWNFPEGLRLKVKVGTFSPHAPHGQKMTLSED
MIEWSTGVTEIPLSVCSQSCSPGFRKSPQEGKAACCFDCIPCANSEITNETDMEQCVKCL
GHQYANTQRNQCLHKIVTFLAYEDPLGKALAGTALSLTALTAAVLGLFVKHQDTAIVKAN
NRTLSYTLLISLLSCFLCSLLFIGHPNTATCILQQTIFAVAFTVAVSTVLAKTITVVLAF
KITAPDKRMRWLLVSGTPNFIIPICSLIQLTLYAVWMGTNPPYIDTDAHSEHGHIIIVCN
KGSLTAFYCVLGYLGSLALVSFTVAFLARNLPDTFNEAKFLTFSMLVFCSVWVTFLPVYH
SSKGKVMVAMEVFSILASAAGLLGCIFVPKCYIILLRPERNSLTGIKNNILSVRKEPS
Download sequence
Identical sequences 10141.ENSCPOP00000017490 ENSCPOP00000017490 ENSCPOP00000017490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]