SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017562 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017562
Domain Number 1 Region: 4-438
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.58e-108
Family L-arabinose binding protein-like 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017562
Domain Number - Region: 440-508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017562   Gene: ENSCPOG00000024100   Transcript: ENSCPOT00000019676
Sequence length 781
Comment pep:known scaffold:cavPor3:scaffold_42:14109857:14120657:-1 gene:ENSCPOG00000024100 transcript:ENSCPOT00000019676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWFWKNYQYVLAFYFAIKEINKDSQLLPNVTLGFHVYNAITSDCFALWSTLHWLCGTEIP
LPNYNCQTYRKFAAVIAGTSAAFSAETGTILELYKFPQVTYGPFDPILSDRHQYPSIYQM
APKDSTLVHAMISLLLHFGWTWVAIFVSDDVKGEKFLGDLKAEMLKKGICVALTEKLPAT
KIMYASSDITFMSKIRVSSANVHILYGEVSSLITVDIAAEFFLTTGKVWIMTAKWDIVVY
EANHMLHSFHGSFSFSPHKGEVPGFRHFLQTTTPSQYPEDFYFSKLWLNFFDCSLPGSQC
GRIGVCPPNTSLEFMPGNTNLMTLSDSSYFIYNAVYALAHVLHKMLLEKAEFASSEDAEQ
PGLLPWQLHPHLKKIEFTNSAGYSISLDEERQHVAQYDIQNTLNFPGGLSVLAKVGEFFF
KRPHGQNLVINDELIEWPVGFTETPQSVCSQSCGPGFSKISQEGRPVCCFTCIFCPERHI
SNQTDAEQCTQCPEHEYTNRNRDRCLPKILDFLSFEDSLGMALTHIALCFSVLTAVILAI
FVKHRDTAIVKANNRTLSYTLLISLLLCFLCCLLFIGRPNTATCILQQMTFGLVFTVAVS
CVLAKTITVVLAFKVTGPEKRMRQLLLLGAPNYIIPICTLIQLTLCGFWMGTNPPYIDTD
AHSEHGHIIIVCNKGSLTAFYCVLGYLGSLALLSFTVAFLARNLPDTFNEAKFLTFSMLV
FCSVWVTFLPVYHSSKGKVMVAMEVFSILASGVGLLGCIFLPKCYVILIRSENNTLTGLK
S
Download sequence
Identical sequences ENSCPOP00000017562 ENSCPOP00000017562 10141.ENSCPOP00000017562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]