SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017669 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017669
Domain Number 1 Region: 8-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-37
Family Laminin G-like module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017669
Domain Number - Region: 1581-1636
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0178
Family Fibrinogen C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017669   Gene: ENSCPOG00000023391   Transcript: ENSCPOT00000020921
Sequence length 1790
Comment pep:known scaffold:cavPor3:scaffold_27:64494:154992:1 gene:ENSCPOG00000023391 transcript:ENSCPOT00000020921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PACLAAQPADLLKVLDFHTLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLY
PASAFPEDFSILTTVKAKKGSQAFLVSIYNEQGIQQIGLEMGRSPVFLYEDHTGKPGPEQ
YPLFRGINLSDGKWHRIALSVHKKNVTLILDCKKKTTKFLDRSDHPIIDVNGIIVFGTRI
LDEEVFEGDIQQLLFVSDHRAAYDDTPQSQDPNPDEYYPDGEGDGDTDDLGKESAPTSKP
VEASRETMEIPEDPILPSTAAPTAPNLAPETSDREGGVEDPGIGDYEYVPIDDYYTAAPY
EDINYGEGLENPEQPTDPNAGAEVPTSTTGASNVSNPAPSPEQGKDDLEGEFTEETIKNV
EDNYYDPYFDPDSDPNNSPSEIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIE
GPPGPEGPAGLPGPPGTTGPTGQVGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGG
GGDAGSKGPMVSAQESQAQAILQQARLALRGPAGPMGLTGRPGPMGPPGSGGLKGEPGDM
GPQGPRGVQGPPGPSGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDP
GPSGPPGPPGEDGERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQPGPK
GNVGPQGEPGPPGQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKE
GPPGEKGGQGPPGPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDR
GEIGPPGPRGEDGPEGPKGRGGPNGDPGPLGPPGEKGKLGVPGLPGYPGRQGPKGSIGFP
GFPGANGEKGGRGTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGER
GPNGPQGPTGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGET
GPMGERGHPGPPGPPGEQGLPGLAGKEGTKGDPGLPGLPGKDGPPGLRGFPGDRGLPGPV
GALGLKGNEGPPGPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGAPGEKGPQ
GPAGRDGLQGPVGLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPI
GQPGPSGADGEPGPRGQQGLFGQKGDEGSRGFPGPPGPVGLQGLPGPAGEKGETGDVGQM
GPPGPPGPRGPSGPPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPGLPGEGGPPGPKGER
GEKGEAGPSGAAGPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDD
GEPGQTGSPGPTGEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQ
GAPGKPGPDGLRGIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLI
GLIGPPGEQGEKGDRGLPGPQGSSGPKGEQGITGPSGPIGPPGPPGLPGPPGPKGAKGSS
GPTGPKGEAGQPGPPGLPGPPGEVIQPLPIQASRTRRNIDASQLLDDAAGESYMDYADGM
EEIFGSLNSLKLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFK
VFCNFTAGGATCVFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSYMDAEGNPVGVVQM
TFLRLLSASAHQNITYHCYQSVAWQDAATGSYDKAMRFLGSNDEEMSYDNNPYIRALVDG
CATKKGYQKTVLEIDTPKVEQVPIVDIMFNDFGDASQKFGFEVGQACFMG
Download sequence
Identical sequences 10141.ENSCPOP00000017669 ENSCPOP00000017669 ENSCPOP00000017669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]