SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017770 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017770
Domain Number 1 Region: 32-143
Classification Level Classification E-value
Superfamily Immunoglobulin 5.54e-21
Family V set domains (antibody variable domain-like) 0.00019
Further Details:      
 
Domain Number 2 Region: 255-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000166
Family SPRY domain 0.042
Further Details:      
 
Domain Number 3 Region: 119-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000179
Family C1 set domains (antibody constant domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017770   Gene: ENSCPOG00000023877   Transcript: ENSCPOT00000027964
Sequence length 322
Comment pep:novel scaffold:cavPor3:scaffold_15:40783454:40793311:-1 gene:ENSCPOG00000023877 transcript:ENSCPOT00000027964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSCSCCLLCHLLSLLLLVQLPNWASTEEFRVLGPPEHIVAVLGGDAVLPCAVSPAMDV
RNMELRWFRTTFTESVFVYRNQQEQTEEQTAEYAGRTSLVTDFLAQGEAALKIHKVQVSD
NGMYNCFFKMGSFFEEASLELRVAGVGSAPHVHIQGPEEDGVRVVCRASRWFPKPQVQWR
DVSGKKILAFSEAHMQDADLLFSVEATVVVREASVGNVSCSVLNPVLGQQKAMAIFIPDE
LQAELGQRKAAYKAAWRKALLYPDWRKEQFQALSVTLDPGSAHKDISISHGNTRLTCVYP
ASNECCSVLGHEGITAGRWCWE
Download sequence
Identical sequences ENSCPOP00000017770 10141.ENSCPOP00000017770 ENSCPOP00000017770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]