SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017856 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017856
Domain Number 1 Region: 31-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-27
Family Laminin G-like module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017856   Gene: ENSCPOG00000024360   Transcript: ENSCPOT00000025047
Sequence length 1259
Comment pep:novel scaffold:cavPor3:scaffold_368:600:15998:-1 gene:ENSCPOG00000024360 transcript:ENSCPOT00000025047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCRGLRQPRAGLCLLLAALQLLPRTQAGDPVDVLEVLGVRGGHAGLPEGPGLCPQRAP
EGDRAFRVGKASAPGAPTWELFPDGHFPVNFSVLATLRAQPADRSVLLSVYDETGTRQLA
LALAPTPGLLGATFGPPPQQPGLADGRWHRLAVSVDGDTVTLVADCEPRPAGSSRGPRSV
STAGLTMLGTLDPEEEAFKGDVQQLLISPDPRAAFRACDGLLPGCDTPSPTPAGPPQGDP
ESPPPPRRKGKGQGKKKGRGRMGRGRKRKSGGPPPGRPRSSPRRTRPLPAGQRPAVPPGP
APAPGSYATRLGLTVAVSQEAPESQDGTRLSLQDTDAAGEEEEESEGGGSTIDPKFRAAE
QPFQTEFQIFPGAAEKGAKGEPAVIEQGWKFEGPPGARGPPGVAGPLGPPGTPGFPGDRG
PPGPAGRPGIPGMDGVRGVPGTVLLMPFHSAGSSLKGPPVSFQQAQAQAVLQQAQLSMKG
PPGPVGLTGRPGPEGLPGYPGLKGEAGELWLQGPRGLQGPPGPPGREGKRGRSGADGARG
LPGDTGPKGDRGFDGLPGLPGEKGQRGDFGPVGQPGPPGEDGGKGAEGPPGPTGQAGEPG
PRGLIGPRGSPGPLGRPGVTGSDGAPGAKGNVGPPGEPGPPGQQGNHGAQGIPGPQGPIG
TPGEKGPPGNPGIPGPPGADGPLGHPGPEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTSG
HRGLQGEKGETGVDGFPGFKGDMGPKGDWGQPGPPGARGEDGPEGLKGPEGLPGEEGSPG
AAGEKGNLGVPGLPGYPGRPGPKGSTGFPGALGPLGEKGRRGKAGQQGQDGERGPPGARG
ERGQPGATGQPGPKGDVGQDGSPGVPGEIGLPGLQGPPGFPGSKGPPGPQGKDGVPGHPG
QRGELGFQGQTGPPGPAGVLGPQGKIGDSGAPGERGHPGPPGPPGEHGLPGPEGGEGAKG
EPGPLGPAGKEGPLGLRGLPGPKGAPGDPGPPGLKGDKGPPGPVGANGSPGEPGPLGPSG
GIGLPGQSGGQGPVGPAGEKGAPGERGAPGPTGKDGVPGPLGPQGPPGAAGPVGEDGDKG
EVGHPGHKGSKGDKGDAGPPGPTGLRGLAGHPGPAGADGAQGRRGPPGLFGQKGDDGVRG
FTGVNGPPGPQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPHGPSGSEGPPGLPGGVGQPG
AVGEKGEPGDAGDPGPPGPPGIQGPKGEVGEKGDSGPSGAAGPPGKKGPPGEDGPKGHM
Download sequence
Identical sequences ENSCPOP00000020258 ENSCPOP00000017856 10141.ENSCPOP00000020258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]