SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017970 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017970
Domain Number 1 Region: 321-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-66
Family SPRY domain 0.0000131
Further Details:      
 
Domain Number 2 Region: 36-109
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-17
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017970
Domain Number - Region: 115-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000124
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017970   Gene: ENSCPOG00000025547   Transcript: ENSCPOT00000021569
Sequence length 503
Comment pep:novel scaffold:cavPor3:scaffold_23:20317409:20334004:1 gene:ENSCPOG00000025547 transcript:ENSCPOT00000021569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTHRSCSLPKVSIASASINRGSQEVSDSRLPSKMAMQDITTELHCPLCKNWFSDPLMLSC
GHNFCQACIQNFWKLEAKETFCPECKMLCQYSNCTFNLVLEKLVEKVKKLPLLKDQPQCS
EHGENLKLFSKPDGKLVCFQCKDARLSMGPSKEFLQIPDAVRFFTEELATYQDQLEATLK
ELQSLRNKQKDAIASCKVLVRPSRKEHVSLEFLKLHQFLHNKEKDIVNALREEGRALSEE
MEHSLSQLQEQGAHAKALLASIKSRMEQQNAFEFLKDITNLLKRCVDFIKITNISLELFL
FPINFPTGYHASTAVKREFCLYPLTLDPKTAHPNLVLSKDRTSVWHGDVKQTMPNDPERF
DSSVAVLSSKGFTSGRWYWEVEVGKKTKWTVGVARESIIRKGNCPLTPERGFWLLRLRNQ
TDLKALDLPSCSLQLTGSLTRVGVYLDYEGGQVSFYNASSMSHIYTFYSGAFGEKLYPYF
CPCLNDGGENKEPLRIVHPQDYK
Download sequence
Identical sequences ENSCPOP00000017970 10141.ENSCPOP00000017970 ENSCPOP00000017970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]