SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018208 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018208
Domain Number 1 Region: 1-432
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-111
Family L-arabinose binding protein-like 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018208
Domain Number - Region: 441-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00165
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018208   Gene: ENSCPOG00000023273   Transcript: ENSCPOT00000024637
Sequence length 768
Comment pep:known scaffold:cavPor3:scaffold_42:13837565:13845583:1 gene:ENSCPOG00000023273 transcript:ENSCPOT00000024637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQYVLAFYFAIEEINKDSQLLPNVTLGFHVYNAIASDHFALWSTLHWLCGTDISLPNYNC
QTHRKFAAVIAGTSAAFSAETGTILELYKFPQVTYGPFDPILSDKYQYPSVYQMAPTDST
LVHAMVSLLLHFGWIWVTIFVSDDVKGEHFLGDLKAEMLKKGICVALTEKLPATKIMYAS
SDITFMSKIRASSANVHILYGEVGSLITVDIAAEFFLTTGKVWIMTAKWDIVVYETNHML
HSFHGSFSFSPHKGEIPGFRHFLQTIKPSQYPEDFYFSKLWLTFFDCSLPGSQCGRIGVC
PPNTSLEFMPGNIDLMTLSDSSYFIYNAVYALAHVLHKMLLQKAELGSSEDAEPPGLFPW
QLHPHLKKVEFTNSAGYSIFLDEERQHVAQYDIQNTLNFPGGLSVLVKVGEFFFKRSHGQ
SLVINEDLIEWPIGFTETPPQSVCSQSCGPGFSKIPQEGRPVCCFTCIFCPERHISNQTD
AEQCTQCPKHEYTNRNRDRCLPKILDFLSFEDPLGMALTQIALSFSVITAVILAIFVKHR
DTAIVKANNRTLSYTLLISLLLCFLCSLLFIGRPNTATCILQQMTFGLVFTVAVSSVLAK
TITVVLAFKVTGRRMRHLLVSGAPNYIIPICTLIQLTLCGFWMGTNPPYIDTDVHSEHGH
IIIVCNKGSLTAFYCVLGYLGSLDLLSFTVAFLARNLPETFNEAKFLTFSMLVFCSVWVT
FLPVYHSSKGKVMVAMEVFSILASSAGLLGCIFLPKCYIILIRSENNT
Download sequence
Identical sequences ENSCPOP00000018208 10141.ENSCPOP00000018208 ENSCPOP00000018208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]