SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018310 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000018310
Domain Number - Region: 133-195
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00763
Family Link domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018310   Gene: ENSCPOG00000024477   Transcript: ENSCPOT00000021212
Sequence length 933
Comment pep:known scaffold:cavPor3:scaffold_80:6552763:6587131:1 gene:ENSCPOG00000024477 transcript:ENSCPOT00000021212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALHSDSEEDLVSYGTGLEPLEEAGERPKKPVPLQDQTVRDEKGRYKRFHGAFSGGFSA
GYFNTVGSKEGWTPSTYVSSRQNRADRSVLSPEDFMDEEDLSEFGIAPKAIVTTDDFASK
TKDKIQEKARQLAAATAPIPGATLLDDFIAPAKLSVGFELLRKMGWKEGQGIGPRTKRRP
RRQKPDPGVKIYGCALPPGGSEESEDEDDDYLPDNVTFAPKDVTPVDFTPKDNVHGLEYK
GLDPHQALFGTSAEHFNLFSGEPQGASSLLGDAGLNKGRKLGISGQAFGVGALEEEDDDI
YATETLSKYDTVLKDEEPGDGLYGWTAPKQYRSQKESEKDLRYIGKILDGFSLASKPLSS
KKIYPPPELPRDYRPVHYFRPVVAATSENSRLLQVLSESAGKAVHDPTTHSRHQLNASKR
GELLGEMPVQGSATSVLEFLSQKDRERIKEMKLATDLKAAQLQARSLAQSAANSRARPSS
PDLGHSPWHVALGGATAPTRASNFRPFAKDPEKQKRYEKFLLHMKKGQKDALERCLDPSM
TEWERGREREEFARAAQLYTASHSTLSSRFTHAKEEDDSEQVEVPRDQENDVTDKQSAVK
MKMFGKLTRDVFEWHPDKLLCKRFNVPDPYPGSTLVGLPRVKRDKYSVFNFLTLPETTPP
PTAPASSEKGPQLRGSDETRKPSRWDAAQHEKKEDSISEFLSLARSRAGAPKPEPSPSVN
TEEGRTPPESLPNKTGHSGAAPQTEGEGSRPSMDLFKAIFASSSESSSEEEEQDNSEDEQ
AGPEEAGFGGTQDSDTREAVSVAHAPAPAPPEPAPVPPFPIQKMQLDEREEFGPRLPPVF
CPSESGALVLPLSEIFKKGKVLHAKMAGERKKDKKKKHKKHKHKSKQKTKKSEKSSSSES
TDSHDSESDGAGTPDLSPEELLRRLKCLPLPQQ
Download sequence
Identical sequences ENSCPOP00000018310 10141.ENSCPOP00000018310 ENSCPOP00000018310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]