SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018426 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018426
Domain Number 1 Region: 4-434
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.65e-104
Family L-arabinose binding protein-like 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018426
Domain Number - Region: 444-504,551-581
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00455
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018426   Gene: ENSCPOG00000024688   Transcript: ENSCPOT00000025956
Sequence length 778
Comment pep:known scaffold:cavPor3:scaffold_95:1321604:1338444:-1 gene:ENSCPOG00000024688 transcript:ENSCPOT00000025956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILKSYQNVLAFIFAIEEINRNPHLLPNITLGYESHNSLHSHGNIVQNILIVQTGQDRIPN
YMCGRESKSLALLTGTSMATAAQSGPLLELYKFPQLTFGSFDPILSESDQFSSLYQMASE
ETALAQGMVSLMLHFSWIWVGVAITEGPKGLRFLADVTKEMDRNRVCMAFVKMIPVDPVS
YMTHTEQHELLVGESSAVNVVIIYYDADSLNDINYSISLHLVTWRVWVTNSQWHADLTGK
KFLLDSFHGTIIFSNHHEEISGFKHFVQTVNLSMYPEDIFLYQFWYWNFNCLISESDCSL
KNCTPNASLAQLPANRFDPAMSDVSYNIYNAVYAVAHALHEMTLQQVQMQNTGSGERRTF
SPWQLHPFLRSIQFTNPAGHHVSLDKKIKLDVKYDILNFWNFPEGLRLKVKVGEFSPYAI
HGQQLSLFQEMIQWATGHTETPHSVCSDSCNPGFRKSPQEGKAACCFDCTPCPENEITND
TDMKNCMKCPDHQYASIQRNQCLPKAVTFLAYEDSMGMTLTGTALSLTSLTAAVLVLFVK
HQDTPIVKANNPALSYTLLISLMFCFLCSLLFIGCPNTISCILQQTTFGVVFTVSVSTVL
AKTVTVMLAFKFTVPGSRMRQLLVSGAPNYIIPTCTLIQLTICGVWMGTSPPFVDTNAHS
EHGHIIIVCNKGSLTAFYFILGYLGSLSLISFIVAFMARNLPDAFNEAKFLTFSMLVFCS
VWVTFLPVYHSSKGKVMVTMEVFCILASSSGLLGCIFFPKCYIILLKPERNSLHEFRN
Download sequence
Identical sequences ENSCPOP00000018426 ENSCPOP00000018426 10141.ENSCPOP00000018426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]