SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018439 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018439
Domain Number 1 Region: 3-436
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.28e-106
Family L-arabinose binding protein-like 0.001
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018439
Domain Number - Region: 445-507
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0144
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018439   Gene: ENSCPOG00000023032   Transcript: ENSCPOT00000022652
Sequence length 784
Comment pep:known scaffold:cavPor3:scaffold_242:437557:448714:1 gene:ENSCPOG00000023032 transcript:ENSCPOT00000022652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTLSNYQNYLSFIFAIEEINKNPHILPNISLGYEFHNFIYSHWRMLENSFILLTGQHEI
PNYTCSRQSKCVAVLTEMSWGTSAEIGPLLELYRFPQITFGSFDSTLTDKVQYPSVYQVA
SKDTYLALGVVSLVLHFHWTWVGLLITEGHKGLQFLSDVRAEMDRNRVCVAFVKMVSTVT
VSYLSATQKHHILTADTSSVNVVVMYYDTDSQTDANYNIWQHSVTWKVWVTNSQWHPDLV
GRNFILDPFHGTLIFSHNHKEISGFKNFVQGATPFKYPEDIYLIMYWYNNFHCSFSEPDC
ILKNCTPNTSLAWLPLNRFDTAMSDGSYHIYNGVYAVAHALHAMVFEEVQCPPMRNRQMM
VFSTWQLHPFLKDIQFNNPVGDQVNFDHSRKLDSEYNIHNFWNFPEGIRHKVKLGTFSSH
APYGQRMSLSEDMIEWAIGITETPQSVCSDSCNLGFRKSPQEGKAACCFDCIPCADNEIA
NDTDMEHCIKCSDHEYANTQQNRCLKKAVTFLAYEDPLGKALAGTALSLTVLTAAALGIF
VKHRDTPIVKANNPAMSYTLLISLIFCFLCSLLFIGRPSTVTCILQHTIFAIVFTVAVST
VLAKTITVVLAFKATAPGRRMRQLLMSGALNYIIPICTLVQLTLCGIWMGTHPPYIDTDA
HSEHGHIIIMCNKGSLRAFYSVLGYLGSLALLSFTVAFLARNLPDTYNEAKFLTFSMLVF
CSVWITLLPVYHSRKGKVIVAMEIFSILASSAGLLGCIFVPKCYIMLFRKEKYSVYSVKH
KTHF
Download sequence
Identical sequences 10141.ENSCPOP00000018439 ENSCPOP00000018439 ENSCPOP00000018439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]