SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018566 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018566
Domain Number 1 Region: 3875-4066
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-39
Family Laminin G-like module 0.00062
Further Details:      
 
Domain Number 2 Region: 4129-4329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.83e-38
Family Laminin G-like module 0.00083
Further Details:      
 
Domain Number 3 Region: 1605-1621,3631-3811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 387-472
Classification Level Classification E-value
Superfamily Immunoglobulin 8.07e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 3177-3271
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-19
Family I set domains 0.0063
Further Details:      
 
Domain Number 6 Region: 1921-2009
Classification Level Classification E-value
Superfamily Immunoglobulin 4.7e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 7 Region: 3258-3351
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 8 Region: 3539-3625
Classification Level Classification E-value
Superfamily Immunoglobulin 4.06e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 3462-3544
Classification Level Classification E-value
Superfamily Immunoglobulin 6.29e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 3075-3168
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 2016-2102
Classification Level Classification E-value
Superfamily Immunoglobulin 8.59e-17
Family I set domains 0.025
Further Details:      
 
Domain Number 12 Region: 2403-2492
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-16
Family I set domains 0.06
Further Details:      
 
Domain Number 13 Region: 1640-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 14 Region: 2989-3084
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 15 Region: 2505-2588
Classification Level Classification E-value
Superfamily Immunoglobulin 5.3e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 16 Region: 1736-1824
Classification Level Classification E-value
Superfamily Immunoglobulin 6.12e-16
Family I set domains 0.0000285
Further Details:      
 
Domain Number 17 Region: 2595-2681
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000114
Family I set domains 0.025
Further Details:      
 
Domain Number 18 Region: 2697-2785
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000032
Family I set domains 0.016
Further Details:      
 
Domain Number 19 Region: 1830-1918
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000382
Family I set domains 0.072
Further Details:      
 
Domain Number 20 Region: 2793-2879
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000266
Family I set domains 0.057
Further Details:      
 
Domain Number 21 Region: 2895-2977
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000346
Family I set domains 0.051
Further Details:      
 
Domain Number 22 Region: 2212-2292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000568
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 
Domain Number 23 Region: 3367-3457
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000028
Family I set domains 0.019
Further Details:      
 
Domain Number 24 Region: 2310-2394
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000502
Family I set domains 0.065
Further Details:      
 
Domain Number 25 Region: 2121-2198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000265
Family V set domains (antibody variable domain-like) 0.067
Further Details:      
 
Domain Number 26 Region: 1527-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 27 Region: 264-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 349-393
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 306-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 30 Region: 1141-1193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 31 Region: 746-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000265
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 32 Region: 806-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000013
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 33 Region: 3807-3848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000302
Family EGF-type module 0.016
Further Details:      
 
Domain Number 34 Region: 175-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 4071-4114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.011
Further Details:      
 
Domain Number 36 Region: 1586-1634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 37 Region: 1201-1246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018566
Domain Number - Region: 1257-1304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00018
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number - Region: 871-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Laminin-type module 0.038
Further Details:      
 
Domain Number - Region: 1485-1529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 1104-1143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family Laminin-type module 0.095
Further Details:      
 
Domain Number - Region: 704-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018566   Gene: ENSCPOG00000026832   Transcript: ENSCPOT00000023850
Sequence length 4357
Comment pep:known scaffold:cavPor3:scaffold_25:13320854:13385850:1 gene:ENSCPOG00000026832 transcript:ENSCPOT00000023850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVTQGLRAYDGPSLPEDTETVAAGRAGWSYSYLSDDEDLLADDASGDELGSGDLGSGDF
QMVYFRALVNFTHSMEYSPQLEDAGSREFRAVSEAVVDRLESEYLKIPGDQVVSVVFIKE
LDGWVFVELDVGSEGNADGAQIQEVLHTVISGGSIGPYITSPQGFQFRRLGTVPQFPRVC
TEAEFACHSHNECVALEYRCDQRPDCRDMSDELNCEEPVPEVSSVPSVVVETSSLIHRPP
EATTTERPSITPRPQALLPHVPRRVPCEPHEAACHSGHCIPKDYLCDGQEDCRDGSDELG
CGPPPPCEPNEFACGNGHCALKLWRCDGDFDCDDHTDEANCPAKHPEEVCAPTQFRCVSS
NTCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQETIQASRGQTVTFTCVAIGVPTPLI
NWRLNWGHIPSHPRVTMTSEGGRGTLTIRDVKEADQGAYTCEAMNARGMVFGIPDGVLEL
IPQRGPCPDGHFYLEHSASCLPCFCFGVTNVCQSSHRFRDQIRLRFDQPGDFKGVNITSA
AQPGMQPLASTQLQVDTALQEFQLVDLSRRFLTHDSFWALPEQFLGNKVDSYGGSLRFKV
RYELARGPLEPVERPDVVLVGAGHRLLSRGHTATHPGTLNQRQVQLSEEHWVHESGRPVQ
RAEMLQVLQSLEAVLIQTVYNAKMASVGLSDITMDTTVTHATDYGRAHSVEECRCPIGYS
GLSCESCDAHFTRVPGGPYLGTCSGCNCNGHSSSCDPVYGHCLNCQHNTEGPQCNKCKAG
FFGDATKPIATACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGY
EGNPIQPGGKCKPTNQAIVRCDERGSARSAGEACLCKNNVVGRLCNECAEGSFHLSTRNP
DGCLKCFCMGVSRQCTSSSWSRAQVLGASEEPTQFSLTNAAGTHTTSEGISLSSSGELVF
SSFHSLLAGPYFWNLPAPFRGDKVTSYGGELRFTVTQQPQPSSEPLRGQPLVVLQGNGIT
LEHHTSREPAPRHPSPFTVPFREQAWQRPDGQPATREHLLMALAGIDALLIRASHTQRPA
ESRVSDISMDVAVPEVTGQDPALEVEQCTCPPGYRGPSCQDCDTGYTRMPSGLYLGTCER
CSCHGHSEACEPETGACQSCQHHTEGPRCEQCQPGYYGDAQRGTPHDCQPCPCHGAPTAG
QAAHTCFLDTDGHPTCDSCSPGHSGRHCERCAPGYYGNPSLGQPCQRDGQVPDETGCNCD
PQGSISSQCDSTGQCQCKAQVEGPTCSHCRPHHFYLSASNPEGCLPCFCMGVTQQCASSS
YARHLIVTRFAPGDFQGFALVNPQRNSRLAGDFTVEPVPEGTQLSFSNFAHLGHESFYWQ
LPEMYQGDKVAAYGGKLRYTLSYTAGLQGSPLSDPDVQIMGNNIMLVASQAAPQGPERKS
YEIVFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPVAASISAVKECRCPPGY
MGLSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHPETGACSQCQHNATGEFCEMCAP
GYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPG
YVGNPNVQGGRCLPQTDQAPLVVQVHPARSVVPQGSAHSLRCQVSGSPPHYFYWSREDGQ
PVPSSTQQRHQGAELHFPSVHPSDAGVYICTCRNLHHVNASRAELLVTEAPSKPITVTVE
EQRSQSVRPGADVTFICTAKSKKSPAYTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDA
GTYVCTGSNMFAMDQGTATLHVQAGGGTLSAPVVSIHPPQLTVQPGQMAEFRCNARGNPT
PNIEWIGGPGGQLPRKAQIYRGILRLPATEPSDQGQYLCRALNNVGQHVGRAVLQVHGGN
GPRVQVSPERIQVHEGHIVRLYCRATGVPTATITWRKEGGSLPPQARSERTDIATLVIPA
ITSADAGFYLCVATSPMGTAQARIQVLVMSASGASSPPVRIESSSPSVTEGQTLDLSCVV
AGLAHTQITWYKRGGSLPPHAQVHGSRLRLPQVSPADSGEYVCRVESEAGPKEASIVVSV
LHSTHPGQGPGPVPGSTQRIRIESSSSHVAEGQTLDLNCVAPGQAQVTWHKRGGSLPARH
QTHGSLLRLNQVSPADSGEYVCHVVLNSEHLESSVLVSIEPSDSIPAPAPIPPVRIESSS
PTVAEGQTLDLNCVVAGQTHAQVTWYKRGGSLPARHQVRGSHLYIFQVSPVDAGEYVCRA
SDGVEASIMVTVTRVQGASFAYPPGSTQPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVT
WHKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCRVVGSPVPLETSVLVSIEPAGSVPAL
GVTPPVRIESSSSHLAEGQTLDLNCMVQGQAHAQITWHKRGGSLPAQHQVHGSRLRLPQV
TPADSGEYVCRVTSDSGTQETSVLVNIQQRLSPSQSQSVVYPIRIESSSASLANGHTLDL
NCLVASHAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSL
IVTIQGSSSSQVPSVSPAIRIESSSPTVVEGQTLDLNCVLAGQTQATIMWYKRGGRLPAR
HQVHGSRLRLHQLSVADSGEYVCRANNNIDAQEASITVSVTPSTSSPSAPSSAGPIRIES
SSSHVAEGQTLDLNCVVPGQPHAQVTWHKRGGSLPARHQAHGSRLRLYQVSPADSGEYVC
RVPVSSGHQEASVLVTIEASGSSTVHVPGAGGAPPIRIETSSSRVAEGQTLDLNCVVPGQ
AHAQVTWHRRGGSLPARHQVHGTLLRLNHVSPADSGEYSCQVAGSSGTLEASVLVTIEAS
SPGPIPAPGLAQSMYIEASSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHG
SRLRLYHVSPADSGEYMCRVADGSGSEQEASFAVTVTPGPGSSYRLRSPVISIDPPSSTV
RPGQDASFRCLIHEGALPISLEWKTRNQELEDNVHVSPNGSIITIVGTQPANHGAYRCVA
SNAYGVAQSVVTLNVHGPPTVSVLPEGPVQVKAGKDIALECVSPGEPRSSVRWTRLGTPA
RLEPRTYGHLNSHAVLKISSAKPSDAGTYVCLAQNALGTAQKQVEVTVDTGTVAPGAPQV
QVEEAELTVEAGHTATLRCSATGNPPPTIHWSKLRSPLPWQHRQEGDTLIIPRVAQQDSG
QYICNATSSIGHAEATIALHVESPPYATIVPEHASVRAGEPVQLQCLAHGTHPLTFQWSR
VGNSLPQRTTTRNQLLHLEPTGPEDSGRYRCQVTNKVGSAEAFAQVQVQGPSGSPPDTHG
PAEPTATVQVTPQLETKSIGASAEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRLQ
NLDQSCQGTYVCQAHGPWGQAQASARLIVQALPSVLINIRTSVQTVVVGHSVEFECLALG
DPKPQVTWSKVGGRLRPGIVQSGSVIRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQA
LPQISTPAEVRVPAGSAAVFPCMASGYPTPDIAWSKLDGDLPPDSRLDNNMLMLPSVRPQ
DAGTYICTATNRQGKVKAFVHLQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIKITFRP
DSADGMLLYNGQKRGPGSPTNLASRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLAL
GQFHTVTLLRSLTQGSLIVGNLAPVNGTSQGKFQGLDLNEELYLGGYPDYAAIPKAGLSS
GFVGCVRELRIQGEEIIFHDLNLTAHGISHCPTCRDRPCQNGGQCQDSESSSYVCICPSG
FTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGVRCEEGVTVTTPSMSG
TGSYLALPALTNTHHELRLDVEFKPLSPDGILLFSGGRIGPVEDFVSLAMVGGHLEFRYE
LGSGLAVLRSPEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYL
GGVEPSVPLSPATNVSAHFHGCVGEVSVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCR
NGATCMPAGEYEFQCLCQDGFKGDLCEHEENPCQLREPCLHGGTCQGTHCLCPPGFSGSH
CQQGPGHGIAESDWHLEGSGGSDAPGQYGVYFHDDGFLALPSHIFSRSLPEVPETIELEV
RTSTANGLLLWQGVEVGEASRGKDFISLGLKDGHLVFSYQLGSGEARLVSEDPINDGEWH
RVTVLREGRRGSIRVDGEELVRGQSPGPNVAVNTKGSVYIGGAPDVATLTGGRFSSGITG
CIKNLVLHSAGPGAPGPQPLDLQHRAQAGANIRPCPS
Download sequence
Identical sequences ENSCPOP00000018566 10141.ENSCPOP00000018566 ENSCPOP00000018566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]